CAZyme Information: TRIREDRAFT_5135-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_5135-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	GL985075|CGC2	58987.82	6.4504

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985075:6908-8464(+)

Full Sequence      

MQPLAPLAPETDGDQATQQVPFRSVSKHTHHTWARTFSCIADVYVQPQSLAEIENVVNLA
HRYRKRVVTVGCGHSPSNIALTSSWLVNLDKYNKILSLDPETGVVVMQSGIRLYTLCEEL
ERHGWAMPNLGSINQQSIAGAISTGTHGSSVRHGLMSEDVLSLKITLANGTTQECSRDAN
SDLFQAALLSLGSLGIISEITFQAVRAFDLRWKQTIDSDLKVFNSWSKDLWTQSEFVRVW
WFPYTRRAVVWQADQTDEAHREPPVSYYDGALGYYVYHNLLYLAQSFPRILPWVEWFVFG
MQYGFANGSTTSAVQPSRKALLMNCLYSQFVNEWAIPLHKGPEALRRLSSWLNQLSPSDP
DYVPHNIPFSAEGLYVHAPVEVRVSDTTLTSNARPLLDPTVKDGPTLYLNATLYRPYLRD
PPCRERYYQAFEWLMKDMGGRPHWAKNFEAYRPEIELMYGDDLDKFRQIRDAVDPEGMFL
GPWHRARILAEDARYELEEVEVERTKSVKNGITVFGKV

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	31	211	4.8e-26	0.40829694323144106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273751	FAD_lactone_ox	2.36e-149	33	480	7	436	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
397924	ALO	4.75e-106	200	485	1	257	D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.
215258	PLN02465	8.34e-44	28	479	84	561	L-galactono-1,4-lactone dehydrogenase
223354	GlcD	6.08e-43	34	479	25	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
130737	GLDHase	5.30e-36	28	264	49	283	galactonolactone dehydrogenase. This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54840.1|AA7	4.56e-08	47	219	69	252
CCA69005.1|AA7	1.49e-07	38	207	55	226
AHG26149.1|AA7	3.22e-07	13	203	16	208
ANH22765.1|AA7	8.09e-07	16	217	91	299
VBB80456.1|AA7	1.47e-06	51	207	21	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7A24_z	6.65e-32	28	250	110	331	Assembly intermediate of the plant mitochondrial complex I [Brassica oleracea]
2VFR_A	2.68e-16	25	210	5	186	Alditol Oxidase from Streptomyces coelicolor A3(2): Native Enzyme [Streptomyces coelicolor A3(2)],2VFS_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Xylitol [Streptomyces coelicolor A3(2)],2VFT_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sorbitol [Streptomyces coelicolor A3(2)],2VFU_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Mannitol [Streptomyces coelicolor A3(2)],2VFV_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sulphite [Streptomyces coelicolor A3(2)]
6EO5_A	2.02e-09	44	226	51	245	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	2.02e-09	44	226	51	245	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
4AUT_A	8.03e-09	33	203	24	197	Chain A, Decaprenyl-phosphoryl-beta-d-ribofuranose-2- Oxidoreductase [Mycolicibacterium smegmatis],4F4Q_A Crystal structure of M. smegmatis DprE1 in complex with FAD and covalently bound BTZ043 [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SGY1|ALO_NEUCR	5.52e-231	7	516	22	548	Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alo-1 PE=3 SV=1
sp|Q6CG88|ALO_YARLI	4.56e-112	28	480	13	514	D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALO1 PE=3 SV=1
sp|O93852|ALO1_CANAL	2.57e-103	27	480	15	543	D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=1 SV=1
sp|Q6CSY3|ALO_KLULA	7.07e-101	26	480	12	511	D-arabinono-1,4-lactone oxidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALO1 PE=3 SV=1
sp|Q6FS20|ALO_CANGA	5.27e-97	33	480	17	509	D-arabinono-1,4-lactone oxidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALO1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000003

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_5135-t26_1-p1.