CAZyme Information: TRIREDRAFT_49976-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_49976-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: glycoside hydrolase family 45

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		24411.01	4.0070

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985070:200211-201061(-)

Full Sequence      

MKATLVLGSLIVGAVSAYKATTTRYYDGQEGACGCGSSSGAFPWQLGIGNGVYTAAGSQA
LFDTAGASWCGAGCGKCYQLTSTGQAPCSSCGTGGAAGQSIIVMVTNLCPNNGNAQWCPV
VGGTNQYGYSYHFDIMAQNEIFGDNVVVDFEPIACPGQAASDWGTCLCVGQQETDPTPVL
GNDTGSTPPGSSPPATSSSPPSGGGQQTLYGQCGGAGWTGPTTCQAPGTCKVQNQWYSQC
LP

Enzyme Prediction     

EC	3.2.1.4:3	3.2.1.4:3	3.2.1.4:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409015	DPBB_GH45_endoglucanase	6.94e-33	20	155	7	149	double-psi beta-barrel fold of glycoside hydrolase family 45 endoglucanase EG27II and similar proteins. This group is made up of endoglucanases from mollusks similar to Ampullaria crossean endoglucanase EG27II, a glycoside hydrolase family 45 (GH45) subfamily B protein. Endoglucanases (EC 3.2.1.4) catalyze the endohydrolysis of (1-4)-beta-D-glucosidic linkages in cellulose, lichenin, and cereal beta-D-glucans. Animal cellulases, such as endoglucanase EG27II, have great potential for industrial applications such as bioethanol production. GH45 endoglucanases from mollusks adopt a double-psi beta-barrel (DPBB) fold.
395595	CBM_1	1.34e-09	209	237	1	29	Fungal cellulose binding domain.
197593	fCBD	3.19e-08	208	241	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
409011	DPBB_EXPA_N	3.62e-08	19	118	4	95	N-terminal double-psi beta-barrel fold domain of the alpha-expansin subfamily. Alpha-expansins (EXPA, expansin-A) have cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. They also affect environmental stress responses. Arabidopsis thaliana EXPA1 is a cell wall modifying enzyme that controls the divisions marking lateral root initiation. Nicotiana tabacum EXPA4 positively regulates abiotic stress tolerance, and negatively regulates pathogen resistance. Wheat TaEXPA2 is involved in conferring cadmium tolerance. Alpha-expansins belong to the expansin family of proteins that contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This model represents the N-terminal domain of alpha-expansins, which adopts a double-psi beta-barrel (DPBB) fold.
409008	DPBB_EXP_N-like	1.15e-07	22	135	4	92	N-terminal double-psi beta-barrel fold domain of the expansin family and similar domains. The plant expansin family consists of four subfamilies, alpha-expansin (EXPA), beta-expansin (EXPB), expansin-like A (EXLA), and expansin-like B (EXLB). EXPA and EXPB display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. EXPA proteins function more efficiently on dicotyledonous cell walls, whereas EXPB proteins exhibit specificity for the cell walls of monocotyledons. Expansins also affect environmental stress responses. Expansin family proteins contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This family also includes GH45 endoglucanases from mollusks. This model represents the N-terminal domain of expansins and similar proteins, which adopts a double-psi beta-barrel (DPBB) fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA83846.1|CBM1|GH45|3.2.1.4	1.10e-171	1	242	1	242
AHK23046.1|CBM1|GH45	1.10e-171	1	242	1	242
AAQ21385.1|CBM1|GH45|3.2.1.4	1.32e-171	1	242	1	242
UKZ52485.1|CBM1|GH45	7.39e-142	1	241	1	238
UKZ88838.1|CBM1|GH45	1.54e-136	1	241	1	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBU_A	2.92e-30	20	168	25	180	Crystal structure of GH45 endoglucanase EG27II in apo-form [Ampullaria crossean],5XBX_A Crystal structure of GH45 endoglucanase EG27II in complex with cellobiose [Ampullaria crossean],5XC4_A Crystal structure of GH45 endoglucanase EG27II at pH4.0, in complex with cellobiose [Ampullaria crossean],5XC8_A Crystal structure of GH45 endoglucanase EG27II at pH5.5, in complex with cellobiose [Ampullaria crossean],5XC9_A Crystal structure of GH45 endoglucanase EG27II at pH8.0, in complex with cellobiose [Ampullaria crossean]
5XCA_A	4.48e-29	20	168	25	180	Crystal structure of GH45 endoglucanase EG27II D137A mutant in complex with cellobiose [Ampullaria crossean]
1WC2_A	3.71e-24	20	171	17	181	Chain A, ENDOGLUCANASE [Mytilus edulis]
3X2L_A	1.47e-09	19	135	12	115	Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],3X2M_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],3X2N_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],5KJO_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],5KJQ_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium]
3X2G_A	7.14e-09	19	135	12	115	Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],3X2H_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],3X2I_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43317|GUN5_HYPJE	1.96e-172	1	242	1	242	Endoglucanase-5 OS=Hypocrea jecorina OX=51453 GN=egl5 PE=3 SV=1
sp|P82186|GUN_MYTED	1.91e-23	20	171	17	181	Endoglucanase OS=Mytilus edulis OX=6550 PE=1 SV=1
sp|G2QCS4|CEL7A_MYCTT	1.87e-11	207	241	430	464	Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=eg7A PE=1 SV=1
sp|Q5B2E8|CBHC_EMENI	8.27e-11	206	242	20	56	1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbhC PE=1 SV=2
sp|Q0CFP1|CBHC_ASPTN	9.17e-10	206	242	19	55	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000271	0.999713	CS pos: 17-18. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_49976-t26_1-p1.