CAZyme Information: TRIREDRAFT_49193-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_49193-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: glycoside hydrolase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		56908.87	4.4739

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985067:412332-414192(+)

Full Sequence      

MKGTFAAAAVAALTGAASASHAHRHAHELFAAKRFQTGEVCVPGCTTIWSTITGEPTLVP
AKVPTTSAAPVEPTTAAAPVTTTEAPAPPPTSEVVVVPVPTPAPVTFPTPGTYTIPATTI
TLTDTTTVCGASSTQVPPGTHTVGGVTTVVETATTVVCPVASISTSGTVVTSVIVQTTYV
CPAAGTYTIAPITTVVPSSTLLVYPVPTSYEPGTYTAPEQVVTVTETDYVTYCPFASSGL
PTTTAAPAPVTTSPAYAPPAPAPAETTQAAPSIQAPKPQPHAPSGGLSGSNDHYGITYTP
YEASSGNCKAASEVDADIAKLKAAGFQVIRVYSTDCNTLENVGSAAKKYGIDLIIGVFVK
GDGCSYDTPDIKSQVDAISSWAQWDMVKLFVVGNEAIMNNFCSPSQLASLVSTVKEKCSG
YNGPYTISETLNIWQRSDVSSAICGVVDVTGANIHPFFNSATTPENAGDFVSGQLDLLGK
ICPGNDVINLECGWPKQGSCNGAACPGDSEQATAIKSIRESCGSKTVFFSYDDDLWKQPG
SFGCEQSWGAAAAF

Enzyme Prediction     

EC	3.2.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.43e-51	295	554	47	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
223021	PHA03247	0.003	55	283	2705	2914	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ73119.1|GH17	4.21e-262	1	554	1	555
UKZ46532.1|GH17	2.17e-260	1	554	1	577
QYS94475.1|GH17	8.06e-252	1	554	1	581
UKZ92158.1|GH17	1.06e-242	1	554	1	560
UKZ62194.1|GH17	4.90e-237	1	554	1	563

PDB Hits     

TRIREDRAFT_49193-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9Q9|BTGE_ASPFC	5.78e-115	1	554	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	5.78e-115	1	554	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	1.52e-111	127	554	137	551	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|A1C499|BTGE_ASPCL	9.88e-106	1	554	1	564	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q0CEX9|BTGE_ASPTN	5.60e-103	8	554	7	558	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005081	0.994907	CS pos: 19-20. Pr: 0.9608

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_49193-t26_1-p1.