CAZyme Information: TRIREDRAFT_4561-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_4561-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: glycosyltransferase family 32

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	GL985068|CGC2	46189.94	6.5006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985068:652250-654148(+)

Full Sequence      

MGMGQCQWSPFRNKVPTQMRRCLPLYITVVCVFLVIVNFDWILAIPNPASVLRREPKAPP
LPGSTFPQKIWQTWKVDPLNFDERDLVTARTWTTINPGMRYEVVTDANEMAYIEDRYGPN
GFDRPDIVEFYKMINLPIIKADLLRYMIMYAEGGIYADIDVETMKPFHRFIPDRYDEKDI
DIIIGVEIDQPDFKDHPILGKKSMSFCQWTFVARPQQPVMMRLIENIMKWFKTVARDQGV
PLGEVQLDFDQVISGTGPSAFTKAMLEEMNRKTKGPKVTWDAFHNLDESKLVGGVLVLTV
EAFCAGQGHSDSGNHNARNALVKHHFHASNWPSRHPRYKHPAYGQVEDCNWVPECVRKWD
EDTSNWDKYSENEQKKILQDIENARLERERQQQALAALP

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_4561-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	88	172	1e-18	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.11e-23	47	293	54	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.13e-10	82	173	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ75513.1|GT32	1.75e-278	9	399	15	405
UKZ48982.1|GT32	1.75e-278	9	399	15	405
QYS97060.1|GT32	2.84e-269	9	399	15	405
UKZ90674.1|GT32	7.96e-263	9	399	15	412
UKZ65216.1|GT32	1.53e-260	9	399	15	412

PDB Hits     

TRIREDRAFT_4561-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.47e-36	66	331	142	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	7.12e-30	66	329	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.59e-27	66	311	130	370	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.26e-24	66	270	96	357	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.989795	0.010211

TMHMM  Annotations     

Start	End
22	44