CAZyme Information: TRIREDRAFT_45252-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_45252-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	GL985058|CGC13	35994.43	6.8455

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985058:140857-141813(-)

Full Sequence      

MRTRNIVALAAIALFWIVFLFRRHIHELGEIALTYSTFYPLLHRHPDILYRHPENVTELS
SEASSTLPPVVVPKIIHQIALGNASVAKYQAAISSCTDLHPEWEHRLWTDVNATAFIAEF
YPDILPHYTGYAQNIQRANILRYALLHHSGGIYVDLDVTCRVALDSTPIVRLPYVSPGAH
PAGVNNAFIATEPGHPFLTQLLENVPSHDLHWALPMRIPYVENMLSTGCMFYSNQWMAYV
RDVLAGRQTSKVYILSDEHGDMAPHMLRGKVTTPIFVHGGASSWHGWDAALFLTIGEHYT
FYLGVLFVALTLIFFAAYF

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	89	165	8.9e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.57e-27	19	319	39	312	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.14e-13	92	169	7	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ93159.1|GT32	5.47e-214	1	318	1	321
UKZ54268.1|GT32	1.69e-213	1	319	1	323
UKZ80044.1|GT32	1.69e-213	1	319	1	323
UKZ66099.1|GT32	8.45e-208	1	318	1	325
QYT01936.1|GT32	2.56e-199	1	319	1	324

PDB Hits     

TRIREDRAFT_45252-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	2.20e-35	72	299	57	269	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	6.42e-32	68	298	58	273	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.16e-32	71	243	81	247	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	9.77e-31	69	298	52	265	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.25e-30	55	298	47	275	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999937	0.000078

TMHMM  Annotations     

Start	End
5	22
299	318