CAZyme Information: TRIREDRAFT_44214-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_44214-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	GL985056|CGC4	30494.76	4.3022

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985056:2060906-2062079(-)

Full Sequence      

MRALSLSLPLSLSLLAASSTAATTCAKGLYMVVARGSEEPAGTGVTGNLTSQIAAKVPGS
EVVAVDYPASFDDYEDSEGDGVKAMRQLLNSYAEACPGNKIAVLGYSQGAQVATDTICGG
AGDPFTSDKGMSDDVMDDVVAVAIFGDPTHVANMTYDRGTSIHNGLFNRSSSSIEVCKSY
ASRIVSYCDTGDIYCDAGSNSTVHHMYIQRYGDEIVDFVVSQFEKSTSSGSGSGTNATTT
TAPAPTVSPTTTSGGNSTVPTRTGGPTTSSTQGSGASALTSSLMLGGLLTVLTAVSQML

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_44214-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	28	222	3.8e-47	0.9735449735449735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.52e-55	27	223	3	173	Cutinase.
369775	PE-PPE	1.46e-05	58	114	1	63	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP57757.1|CE5	1.07e-186	1	299	1	299
QYT01571.1|CE5	8.78e-137	8	299	4	298
UKZ54574.1|CE5	3.91e-133	8	299	4	298
UKZ80355.1|CE5	3.91e-133	8	299	4	298
UKZ86298.1|CE5	1.27e-116	7	229	3	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	8.70e-24	29	222	5	205	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	8.70e-24	29	222	5	205	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	1.23e-22	29	222	5	205	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	1.73e-21	29	222	5	205	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	8.11e-23	29	222	32	232	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.00e-20	29	263	36	269	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	1.18e-19	29	228	28	234	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|P63880|CULP1_MYCBO	7.00e-12	29	209	38	198	Carboxylesterase Culp1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2006C PE=3 SV=1
sp|P9WP42|CULP1_MYCTO	7.00e-12	29	209	38	198	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000273	0.999723	CS pos: 21-22. Pr: 0.9685

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_44214-t26_1-p1.