CAZyme Information: TRIREDRAFT_42152-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_42152-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: glycoside hydrolase family 75

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		24234.92	4.2212

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985077:533772-534634(+)

Full Sequence      

MQSSILFTLLAAGTTSVAYTIPANLQAIYNAHKAGTCAKPLSGTSSSGAVFCGDIPNAIF
LKGSSGNYDNMDVDCDGADDKAGDCSNDPTGFGETAFKDTVQSYGIPDLNANIHPYVVVN
EKPFFDGQQYIKPLSVMAVVCNNQVWYGIWGDTNTEPTTGEASISLAQLCFPNEHLNGDF
GHGAKDVLYIGFIGDDTVPGKNGAKWNAQNVSEFEASIKSLGDRLVQGL

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	13	227	3.1e-76	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	4.06e-89	71	227	1	164	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ76881.1|GH75	7.27e-150	1	229	1	230
UKZ51051.1|GH75	8.68e-150	1	229	1	230
QYS97917.1|GH75	3.91e-146	1	229	1	230
UKZ63964.1|GH75	3.76e-145	1	229	1	230
UKZ88836.1|GH75	2.19e-141	1	227	1	227

PDB Hits     

TRIREDRAFT_42152-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	2.58e-88	18	229	18	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q875I9|CSN_ASPFM	6.60e-83	3	229	4	236	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	4.52e-79	3	229	4	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.47e-78	10	229	9	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.47e-78	10	229	9	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000424	0.999537	CS pos: 20-21. Pr: 0.8385

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_42152-t26_1-p1.