CAZyme Information: TRIREDRAFT_39755-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_39755-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: glycoside hydrolase family 16

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		37770.60	4.4275

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985064:281080-282138(-)

Full Sequence      

CDCFVTNGTQPGYFSNHMFFDFRNLTRDAGIPPIVTNVTNATYVPPTSDYFSSDEWTSVW
QLQGWSNSEGKGKGLSGAATVLMAYSPANVYIEENKDEDADSQTYLTLRTQREPKFQSAA
AFQTKTSDYQFVSLRMLARTIGSPGAVTAMFTYRDATASSSLQESDFEVLTRGPRENVQL
TNQPSFDSDGKVKPEATTNATLPGGMIWSQWAVYRLDWTADSSVWYVDGQQLANITFQVP
QDAAGINVNAWSDGGSWSGNMSVYDQANLQIQWIEMIYNTSSSSSSSSASQRKWKRDPTG
FLWGRDAGPRGGLPRRRDFDGDGCKVVCSIDEVTEQGVATML

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_39755-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	59	276	3.5e-91	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	4.09e-49	54	276	7	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	5.56e-04	122	275	108	261	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185684	GH16_lichenase	0.002	106	274	43	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185693	GH16_laminarinase_like	0.003	196	260	145	216	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS98274.1|GH16_22	5.03e-193	1	342	42	375
UKZ51547.1|GH16_22	1.76e-190	1	342	24	360
UKZ88547.1|GH16_22	2.62e-188	1	342	42	377
UKZ63659.1|GH16_22	6.19e-182	1	342	48	384
UKZ77369.1|GH16_22	7.14e-177	18	342	1	320

PDB Hits     

TRIREDRAFT_39755-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TRIREDRAFT_39755-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999857	0.000174

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_39755-t26_1-p1.