CAZyme Information: TRIREDRAFT_23367-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_23367-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: choline oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543	GL985086|CGC2	60138.55	7.3553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985086:37963-39594(+)

Full Sequence      

MTTRSLPSNAGSAFDYIIVGGGTAGCVIASRLSSYLPERRVLLIEAGPSDFNLNHVLNLR
EWLSLLGGDLDYDYGTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFRYDMDRWVAQG
CKGWTFENVTRHIDNLRNTFQPVHARHRNQLCKDWIQACASALNVPIIDDFNAEIREKGQ
LTQGTGFFNVSYNPDDGRRSSASVAYIHPILRGEERRPNLTILTEAHVSKILVENDVASG
IIVHLASGERVVLKPRKEIILCAGAVDTPRLMLHSGLGPRSQLEGLGIPVVKDIPGVGEN
LLDHPETIIIWELNKPVPPNQTTMDSDAGLFLRREPTNAAGTDGNAADIMMHCYQIPFTL
NTERLGYRRIQDGYAFCMTPNIPRPRSRGRLYLTSADPAVKPALDFRYFTDPEGYDAATF
VAGIKAARKVAQQSPFKEWLKEEVAPGPKVQTDEEISEYARRVAHTVYHPAGTTKMGDVT
KDQAAVVDHELKVRGINKLRIADAGVFPEMPTINPMLTVLAIGERAAELIAMEEGWKPKT
SKL

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_23367-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	540	3.5e-93	0.517799352750809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.57e-118	7	531	1	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.00e-113	14	530	6	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.74e-42	385	526	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.10e-33	1	523	43	569	Protein HOTHEAD
366272	GMC_oxred_N	1.07e-26	14	306	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ57294.1|AA3_2	0.0	1	543	1	543
UKZ83009.1|AA3_2	0.0	1	543	1	543
QYT05116.1|AA3_2	0.0	1	543	1	543
UKZ91573.1|AA3_2	0.0	1	543	1	543
UPK97583.1|AA3_2	0.0	1	543	1	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.49e-123	14	530	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	2.10e-123	14	530	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	5.92e-123	14	530	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6YS2_AAA	7.83e-63	10	530	4	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	1.66e-62	10	530	80	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	7.66e-123	14	530	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	2.18e-81	13	531	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	3.94e-75	14	530	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	9.37e-74	14	530	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	1.40e-69	12	530	3	530	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000029

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_23367-t26_1-p1.