CAZyme Information: TRIREDRAFT_22197-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_22197-t26_1-p1
• CAZy Family: GH128
• CAZyme Description: glycoside hydrolase family 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		55081.73	5.4914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985063:425315-427045(-)

Full Sequence      

MPESLALPNDFEWGFATAAYQIEGAVKEGGRGPSIWDTYCHLEPSRTNGANGDVACDHYH
RYDEDFDLLTKYGAKAYRFSLSWSRIIPLGGRLDPVNEEGIEFYSKLIDALLRRGITPWV
TLYHWDLPQALHDRYGGWLNVEEVQLDFERYARLCFERFGDRVQNWITINEPWIQAIYGY
ATGSNAPGRSSINKHSTEGNTATEPWLAGKAQIMSHARAVAVYSRDFRPSQKGQIGISLN
GDYYEPWDSNEPRDKEAAERRMEFHIGWFANPIFLKKDYPESMKKQLGERLPALTPADFA
ILNAGETDFYGMNYYTSQFARHLDGPVPETDYLGAIHEHQENKDGSPVGEESGLAWLRSC
PDMFRKHLARVYGLYGKPIYITENGCPCPGEENMTCEEAVNDPFRIRYFDSHLDSISKAI
TQDGVVVKGYFAWALLDNLEWSDGYGPRFGVTFTDYTTLKRTPKKSALVLKDMFAARQRV
KVAA

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	477	6.5e-160	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	3.52e-169	7	473	5	447	Glycosyl hydrolase family 1.
274539	BGL	2.25e-162	8	468	1	424	beta-galactosidase.
225343	BglB	1.03e-149	5	475	2	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
184102	PRK13511	6.16e-109	6	471	4	460	6-phospho-beta-galactosidase; Provisional
215435	PLN02814	3.30e-106	7	467	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP57758.1|GH1|3.2.1.21	0.0	1	484	1	484
ABE22339.1|GH1|3.2.1.21	0.0	1	484	1	484
CBG21221.1|GH1|3.2.1.21	0.0	1	484	1	484
UKZ87355.1|GH1	0.0	1	484	1	484
QYS96282.1|GH1	0.0	1	484	1	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JBO_A	0.0	1	484	2	485	Trichoderma harzianum GH1 beta-glucosidase ThBgl2 [Trichoderma harzianum]
6KHT_A	0.0	2	478	16	492	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]
4MDO_A	1.93e-182	4	474	23	492	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	6.63e-180	7	474	3	459	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	8.79e-178	5	474	1	459	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	6.11e-178	7	476	11	473	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	6.44e-166	7	474	6	456	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	1.54e-144	8	474	23	511	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	3.98e-140	6	473	49	518	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	1.67e-139	8	467	22	472	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_22197-t26_1-p1.