CAZyme Information: TRIREDRAFT_123989-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_123989-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: glycoside hydrolase family 7

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		54111.12	4.3613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985084:332456-334131(+)

Full Sequence      

MYRKLAVISAFLATARAQSACTLQSETHPPLTWQKCSSGGTCTQQTGSVVIDANWRWTHA
TNSSTNCYDGNTWSSTLCPDNETCAKNCCLDGAAYASTYGVTTSGNSLSIGFVTQSAQKN
VGARLYLMASDTTYQEFTLLGNEFSFDVDVSQLPCGLNGALYFVSMDADGGVSKYPTNTA
GAKYGTGYCDSQCPRDLKFINGQANVEGWEPSSNNANTGIGGHGSCCSEMDIWEANSISE
ALTPHPCTTVGQEICEGDGCGGTYSDNRYGGTCDPDGCDWNPYRLGNTSFYGPGSSFTLD
TTKKLTVVTQFETSGAINRYYVQNGVTFQQPNAELGSYSGNELNDDYCTAEEAEFGGSSF
SDKGGLTQFKKATSGGMVLVMSLWDDYYANMLWLDSTYPTNETSSTPGAVRGSCSTSSGV
PAQVESQSPNAKVTFSNIKFGPIGSTGNPSGGNPPGGNPPGTTTTRRPATTTGSSPGPTQ
SHYGQCGGIGYSGPTVCASGTTCQVLNPYYSQCL

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	20	447	2.7e-185	0.9927710843373494
CBM1	482	510	9.4e-16	0.9655172413793104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	20	446	1	434	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	0.0	25	441	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
197593	fCBD	5.36e-12	482	514	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.41e-11	482	510	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGR44817.1|CBM1|GH7|3.2.1.176	0.0	1	514	1	514
CAA49596.1|CBM1|GH7|3.2.1.176	0.0	1	514	1	513
CAH10320.1|CBM1|GH7|3.2.1.176|3.2.1.132	0.0	1	514	1	513
AAQ76092.1|CBM1|GH7|3.2.1.176	0.0	1	514	1	514
CAR96030.1|CBM1|GH7|3.2.1.176|3.2.1.132	0.0	18	514	1	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEL_A	5.83e-315	19	451	2	434	Chain A, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],1CEL_B Chain B, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei],1DY4_A CBH1 IN COMPLEX WITH S-PROPRANOLOL [Trichoderma reesei QM9414],2V3I_A Chain A, EXOGLUCANASE 1 [Trichoderma reesei],2V3R_A Chain A, EXOGLUCANASE 1 [Trichoderma reesei],4P1J_A Chain A, Exoglucanase 1 [Trichoderma reesei],6GRN_A Chain A, Exoglucanase 1 [Trichoderma reesei]
4D5Q_A	1.67e-314	19	451	2	434	Hypocrea jecorina Cel7A (wild type) soaked with xylopentaose. [Trichoderma reesei QM9414]
4V0Z_A	3.37e-314	19	451	2	434	o-nitrophenyl Cellobioside as an Active Site Probe for Family 7 Cellobiohydrolases [Trichoderma reesei QM9414]
4P1H_A	1.80e-313	19	449	2	432	Crystal structure of wild type Hypocrea jecorina Cel7a in a monoclinic crystal form [Trichoderma reesei QM6a],5TC9_A Wild type TrCel7A catalytic domain in a closed state [Trichoderma reesei QM6a]
4C4C_A	1.95e-313	19	451	2	434	Chain A, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Trichoderma reesei],4C4D_A Chain A, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Trichoderma reesei],4D5J_A Chain A, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Trichoderma reesei],4D5P_A Hypocrea jecorina cellobiohydrolase Cel7A E217Q soaked with xylopentaose. [Trichoderma reesei QM9414],4D5V_A Chain A, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Trichoderma reesei],7CEL_A Chain A, 1,4-BETA-D-GLUCAN CELLOBIOHYDROLASE I [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A024RXP8|GUX1_HYPJR	0.0	1	514	1	514	Exoglucanase 1 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=cbh1 PE=1 SV=1
sp|P19355|GUX1_HYPRU	0.0	1	514	1	514	Exoglucanase 1 OS=Hypocrea rufa OX=5547 GN=cbh1 PE=3 SV=2
sp|P62694|GUX1_HYPJE	0.0	1	514	1	513	Exoglucanase 1 OS=Hypocrea jecorina OX=51453 GN=cbh1 PE=1 SV=1
sp|P62695|GUX1_TRIKO	0.0	1	514	1	513	Exoglucanase 1 OS=Trichoderma koningii OX=97093 GN=cbh1 PE=3 SV=1
sp|Q9P8P3|GUX1_TRIHA	2.87e-295	1	514	1	505	Exoglucanase 1 OS=Trichoderma harzianum OX=5544 GN=cbh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000250	0.999734	CS pos: 17-18. Pr: 0.9746

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_123989-t26_1-p1.