CAZyme Information: TRIREDRAFT_123173-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_123173-t26_1-p1
• CAZy Family: PL7
• CAZyme Description: glycosyltransferase family 41

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1738	GL985073|CGC1	193142.63	8.3381

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985073:626420-633473(-)

Full Sequence      

MLSPLRSRLVKATFLGTCRQVRLASSARYPQAVSPLAFDLHSPSHPSKDEKTAPIIFLHG
LFGSKKNNRAISKALARDLKTHVYTVDLRNHGESPHDPRHDYVAMTEDLLAFIDQHGLKE
PTLIGHSMGAKTAMSAALRSPETVAKVVAVDNAPVDVTLSRTFASYVRGMKKIEEAKVTR
QSEADAILRDYEESLPIRQFLLGNLYRSPEDGIQRFRVPLDILGRSLDHLGDFPYKNPGE
ARYTKPALFVRGTQSKYVPDDVLPIIGQFFPRFQLVDIDAGHWLISEQPEAFRQEFYYLL
HYTKLYPGRDTVRRTNPDPVPREAALDWPTGGARARLCPRHRHRPRPRPPNPRPPSNPPL
PSVVGMLPLVQTHPRVVPVPLDFESFGAPAARPEADRRAVASPYHRGVSHSYGGPVSAAP
AGQGSRDHDYHLRRKTPRGTIDAGYDGSPTQLSPGPPPLKQLILPTPSGIYPYVPPNNLP
FHAKPRLSNTDPISLGQAPAVSPWSLSYGGQNFVLSSGSPMVPQPGPSWQPYGYPMFSQV
PGMHQPLMRAAEYNVRAFCPPPASAPDAATFNQFGWQLGASQQNLGYFDQSQYPEPRSML
LPASFSHHTSDVQLPYRPVPDFKAGLEVTSFPSQPLVQGSYLGQSSLVEDVPAGEQYAVQ
ASFTEKVYSKAQDHYVELLAYLQTARRLDQMSTGGNSSSSHVEAITNLAATLYCLNRQEE
AEQHWLRAIKLRPDHLEATEQLVGLLYKKRSREAIDIICFVQQALSLKRGSPNRTSYPAS
SDDCLPSQQPSKFAAPFSYHYETASTTSGHSSRRSDFGSSGYALPNSENGRILALVHAKG
TILYGLKDIERASEAFEEAVLISVGERIRSVQDLVNRIHAVLAPAGSHSTGSDRRPVSRR
PLLLPPEKARQTAHLVFAADGGGSELPGLAFVPEGAARRVAVQTTSNALLSLAKIFQDAM
SGGSTVPSLLRQPTGIGDILALYYLSLSLQESPSTANNIGILLAGVQQTAPSNVTTPGTV
PPRPSLPGVVPGSGLALALAYYNYGLRLDPRHVHLHTNLGSLLKDVGQLDLAIQMYERAV
SCDRTFDIALTNLANAVKDKGRIKDAIAYYRRAVDSNPDFAEAVCGLLTALNSVCDWRGR
GGALLESGKYDRWHVDDEGTLVDVRTAMHGSGLTQRVIGIISQQLDDASQWGRGILQQPT
IHGLVEQLQEFCHNPKFDLENAIRAWAHKSWEGSRLVRLVERATRVILWKWYHDRHVAQR
KATPSQYYRPQLPSSLTIPSAPTVLPFHTFTYPLSAKDIRSISQRNAMRISCSTLRAPWL
PPTVYPPPPPPNPYLNVGYVSSDFNNHPLAHLMQSVFGFHNPQRARAFCYATTPSDKSIH
RQQIEREAPVFRDVSSWPAEKLIEQIVRDEIHILVNLNGYTRGARNEIFAARPAPIQMSF
MGFAGTLGAEWCDYLLADTTAVPPSTLRPWRNNTTIEDVFQDMTEGDERQWMYSENIIFC
RDTFFCCDHAQSCDDNERDMTWEDEERRRWKMRKELFPTIADDAIILANFNQLYKARETN
LRQTAEAWAGAEVASRLVFTDVAPKNQHINRARVCDLFLDTAECNAHTTAADVLWSSTPL
LTLPRYSYKMCSRMAASILRGALPKSAEGQQAALELIADGETEYEDQAAELAGGLTYVMT
DEGYGRGKGRLAELRKLLWDSRWSCGLFNTRRWVNDLERAYEEAWRRWVAGKGGDIYL

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_123173-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404688	Glyco_transf_41	5.03e-78	1282	1717	28	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
182637	PRK10673	1.19e-45	35	291	2	243	esterase.
226428	Spy	2.04e-44	1338	1730	263	620	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
223669	MhpC	5.94e-27	54	295	23	274	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].
395444	Abhydrolase_1	2.09e-25	54	289	2	245	alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ83676.1|GT41	0.0	1	1738	1	1649
QYT05972.1|GT41	0.0	366	1738	1	1564
UKZ94216.1|GT41	0.0	366	1738	1	1581
UKZ69990.1|GT41	0.0	366	1738	1	1583
UKZ57979.1|GT41	0.0	366	1738	1	1257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NPR_A	2.99e-58	1282	1735	179	710	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	3.04e-58	1282	1735	180	711	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]
3PE3_A	3.29e-58	1282	1735	185	716	Chain A, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens],3PE3_B Chain B, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens],3PE3_C Chain C, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens],3PE3_D Chain D, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens],3PE4_A Structure of human O-GlcNAc transferase and its complex with a peptide substrate [Homo sapiens],3PE4_C Structure of human O-GlcNAc transferase and its complex with a peptide substrate [Homo sapiens],3TAX_A A Neutral Diphosphate Mimic Crosslinks the Active Site of Human O-GlcNAc Transferase [Homo sapiens],3TAX_C A Neutral Diphosphate Mimic Crosslinks the Active Site of Human O-GlcNAc Transferase [Homo sapiens],4AY5_A Human O-GlcNAc transferase (OGT) in complex with UDP and glycopeptide [Homo sapiens],4AY5_B Human O-GlcNAc transferase (OGT) in complex with UDP and glycopeptide [Homo sapiens],4AY5_C Human O-GlcNAc transferase (OGT) in complex with UDP and glycopeptide [Homo sapiens],4AY5_D Human O-GlcNAc transferase (OGT) in complex with UDP and glycopeptide [Homo sapiens],4AY6_A Human O-GlcNAc transferase (OGT) in complex with UDP-5SGlcNAc and substrate peptide [Homo sapiens],4AY6_B Human O-GlcNAc transferase (OGT) in complex with UDP-5SGlcNAc and substrate peptide [Homo sapiens],4AY6_C Human O-GlcNAc transferase (OGT) in complex with UDP-5SGlcNAc and substrate peptide [Homo sapiens],4AY6_D Human O-GlcNAc transferase (OGT) in complex with UDP-5SGlcNAc and substrate peptide [Homo sapiens],4CDR_A Human O-GlcNAc transferase in complex with a bisubstrate inhibitor, Goblin1 [Homo sapiens],4CDR_B Human O-GlcNAc transferase in complex with a bisubstrate inhibitor, Goblin1 [Homo sapiens],4CDR_C Human O-GlcNAc transferase in complex with a bisubstrate inhibitor, Goblin1 [Homo sapiens],4CDR_D Human O-GlcNAc transferase in complex with a bisubstrate inhibitor, Goblin1 [Homo sapiens],4GYW_A Crystal structure of human O-GlcNAc Transferase in complex with UDP and a glycopeptide [Homo sapiens],4GYW_C Crystal structure of human O-GlcNAc Transferase in complex with UDP and a glycopeptide [Homo sapiens],4GYY_A Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc and a peptide substrate [Homo sapiens],4GYY_C Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc and a peptide substrate [Homo sapiens],4GZ3_A Crystal structure of human O-GlcNAc Transferase with UDP and a thioglycopeptide [Homo sapiens],4GZ3_C Crystal structure of human O-GlcNAc Transferase with UDP and a thioglycopeptide [Homo sapiens],4GZ5_A Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc [Homo sapiens],4GZ5_B Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc [Homo sapiens],4GZ5_C Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc [Homo sapiens],4GZ5_D Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc [Homo sapiens],4GZ6_A Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc [Homo sapiens],4GZ6_B Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc [Homo sapiens],4GZ6_C Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc [Homo sapiens],4GZ6_D Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc [Homo sapiens],4N39_A Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) [Homo sapiens],4N3A_A Crystal Structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (1-26)E10A [Homo sapiens],4N3B_A Crystal Structure of human O-GlcNAc Transferase bound to a peptide from HCF-1 pro-repeat2(1-26)E10Q and UDP-5SGlcNAc [Homo sapiens],4N3C_A Crystal Structure of human O-GlcNAc Transferase bound to a peptide from HCF-1 pro-repeat2(1-26) and UDP-GlcNAc [Homo sapiens],4XI9_A Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RBL2) [Homo sapiens],4XI9_B Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RBL2) [Homo sapiens],4XI9_C Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RBL2) [Homo sapiens],4XI9_D Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RBL2) [Homo sapiens],4XIF_A Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (keratin-7) [Homo sapiens],4XIF_B Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (keratin-7) [Homo sapiens],4XIF_C Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (keratin-7) [Homo sapiens],4XIF_D Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (keratin-7) [Homo sapiens],5BNW_A The active site of O-GlcNAc transferase imposes constraints on substrate sequence [Homo sapiens],5C1D_A Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RB2L) [Homo sapiens],5VIE_A Chain A, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens],5VIE_C Chain C, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens],5VIF_A Electrophilic probes for deciphering substrate recognition by O-GlcNAc transferase [Homo sapiens],6E37_A O-GlcNAc Transferase in complex with covalent inhibitor [Homo sapiens],6MA1_A Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor 4a [Homo sapiens],6MA2_A Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor ent-1a [Homo sapiens],6MA3_A Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor 2a [Homo sapiens],6MA4_A Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor 3a [Homo sapiens],6MA5_A Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor 1a [Homo sapiens]
6TKA_AAA	3.50e-58	1282	1735	184	715	Chain AAA, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens]
5LVV_A	4.88e-58	1282	1735	206	737	Human OGT in complex with UDP and fused substrate peptide (Tab1) [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	8.38e-64	1282	1732	535	959	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|P56558|OGT1_RAT	3.64e-56	1282	1735	493	1024	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	3.88e-56	1282	1735	503	1034	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|P81436|OGT1_RABIT	3.88e-56	1282	1735	503	1034	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	5.14e-56	1282	1735	503	1034	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_123173-t26_1-p1.