CAZyme Information: TRIREDRAFT_122993-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_122993-t26_1-p1
• CAZy Family: GT64
• CAZyme Description: glycosyltransferase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	GL985072|CGC4	68338.08	7.2741

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985072:191291-193162(+)

Full Sequence      

MMDPFHNGSIPIVTKGRPTSYLRMLLNVVGCLLLTPAYWAVSVHCRYPVTLDLILTIVLT
ELNRLVNEGRRLQFYEQEEPPERPLASPRDERSDDGFYDEKKVGFSVTEIEPQSRLDSMA
AVVGWREDPALFARALQSYKSAKHCMFMLVGIDGDEAADQDMVDVFNYVYPTQSKVIHVP
QPLGEVAEQFIAKHISVCKQNGQPVNLDECYEIAMRHCFQLARTILEQEKVDLASVRHLC
LRQRHMHKKGVMFTTFVFALVIADVLGVEFLWSSDSDTLVFPDSIHKTVDAIAHDPTVGG
ASSGLVVHNGYETTVTNLAATVYWGELYLTRSMPAFTATSDCQSGPSTVFRLAAMPAILI
PWYLQTLMGKRMIINEDRHLTTNLLLRGWGVVFASDVLAATDTPTTMARWLKQQVRWARA
THIESLLQPRVYLVTHPLLFYSMSKRELGPVIAFVAALWYFFTGERLILVFVSDVLVRIA
ASALYNLLRNPHRLERASLKWIVPGMFFYHLPLPAVHVWSLLTLTADGWGTSMRNSSELA
KKDSARQAWWETGFFVGWMGVVAGSVARWLATHWAMQRHEVWGAMAVSFAAAAFVAWRCT
IYQQS

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_122993-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	1.43e-15	240	421	57	232	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224136	BcsA	1.20e-14	275	524	145	368	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	7.59e-08	275	462	6	184	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133043	CESA_CelA_like	1.65e-06	374	419	183	228	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133045	CESA_like	2.06e-05	275	354	86	165	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT00560.1|GT2	0.0	2	605	1	604
UKZ55490.1|GT2	0.0	1	605	1	603
UKZ81260.1|GT2	0.0	1	585	1	583
UKZ95583.1|GT2	0.0	1	605	1	607
UKZ71336.1|GT2	0.0	1	605	1	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	4.76e-22	122	566	89	492	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.98e-21	122	566	89	492	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92839|HYAS1_HUMAN	3.43e-26	122	534	101	493	Hyaluronan synthase 1 OS=Homo sapiens OX=9606 GN=HAS1 PE=1 SV=2
sp|Q61647|HYAS1_MOUSE	3.53e-26	122	534	105	498	Hyaluronan synthase 1 OS=Mus musculus OX=10090 GN=Has1 PE=1 SV=1
sp|P26024|NODC_BRADU	6.65e-19	275	458	140	322	N-acetylglucosaminyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=nodC PE=3 SV=2
sp|P04340|NODC_RHILV	2.49e-18	269	427	133	290	N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae OX=387 GN=nodC PE=3 SV=1
sp|P50357|NODC_SINFN	7.29e-18	275	452	140	316	N-acetylglucosaminyltransferase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=nodC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999975	0.000050

TMHMM  Annotations     

Start	End
20	42
250	272
347	364
448	470
502	524
549	571
581	602