CAZyme Information: TRIREDRAFT_120923-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_120923-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: glycosyltransferase family 32

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37954.56	7.6045

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985060:460344-461498(+)

Full Sequence      

MLKAHDAGYLNIRLERRARTLLWLAILSSLAAIFCFRHLLYTSGTLLALPASWAADHETF
ILSEQRDAFDVTFANYSINQLSAAPYEDLVPPVLHHIALGSHGTHWRTEWKETVQSCIDI
HPGWETHIWTDETASRFVEDKFPDLKPMWDNYAYPVERIDALRYMLLYEYGGVVLDMDLK
CTRALGPLRRFSFVAPEAYPAGFSIGFMMASRRNDFVGALVGNLETYNKRWLGLPYATVM
FSTGCHYASVVHAAQPQPGRGELKILPGPMHSLNGRVKTPIFEHLGSSSWHSYDARFIMS
LGRRLHQIVFFCRSTDFARSGPQGLPRLEFHIF

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_120923-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	109	188	5.6e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.71e-19	25	305	12	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.21e-14	109	188	3	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	2.07e-05	112	215	63	178	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT03157.1|GT32	2.86e-198	1	312	1	310
UKZ53116.1|GT32	2.00e-182	1	294	1	292
UKZ64181.1|GT32	1.09e-181	15	312	14	309
UKZ97012.1|GT32	4.58e-181	1	312	1	310
UKZ78951.1|GT32	8.53e-166	50	312	7	267

PDB Hits     

TRIREDRAFT_120923-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.61e-35	83	309	48	270	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.67e-34	72	318	45	289	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	3.24e-31	90	311	57	272	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.69e-30	89	309	61	278	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	9.76e-29	77	309	72	300	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999812	0.000208

TMHMM  Annotations     

Start	End
21	40