CAZyme Information: TRIREDRAFT_120807-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_120807-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: glycosyltransferase family 66

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743		83081.38	8.5758

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985059:1451959-1454538(-)

Full Sequence      

MAAKSPQGPAVGYTTESTRTLLRVVILCFIAAAAISSRLFSVIRFESIIHEFDPWFNFRA
TKYLVANGFHKFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGAIYHALRTLTVPVDIRNIC
VLLAPACSGLTAFATYLLTNEMTTSPSAGLLAAVFMGIAPGYISRSVAGSYDNEAIAIFL
LVFTFYLWIKALKLGSMLWGALCALFYGYMVASWGGYAFITCLLPVHALVLICMGRYSTR
LYVSYTTWYALGTLASMQIPFVGFLPIKTSEHMPALGIFGFIQLIGFIQYVRSAISGRQF
QTFLVTILVATFGLGLLGLVALTSLGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPT
AWPSFFFDLNFLIWLFPAGVYLCFQDLKDEHVFVVVYALFGSYFAGVMVRLMLTLTPVVC
VAAAMAASQILDTYLSWRTPAPAAEEQEAPKKAKGGLRGSDKPTVGIYSNLTKVMVSGSM
LVYLLMFVSHCTWVTSNAYSSPSVVLASRMPDGSQHIIDDYREAYQWLRQNTKEDAKIMS
WWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSREEVSYPIMRQHEVDYILVVFGG
LLGYSGDDINKFLWMVRIAEGIWPEEVKERDFFTAQGEYRVDEGATETMKNSLMYKMSYY
NYASLFPAGQAADRVRGVRIPDQGPVLNTIEEAFTSENWIIRIYKVKDLDNIGRDHANAA
AFERGQKKKKPTKKRGARVLRVD

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	22	664	6.4e-193	0.8528138528138528

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	3.26e-140	21	500	1	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.36e-106	19	714	16	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	1.66e-23	24	555	3	547	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
404170	PMT_2	0.003	122	213	26	114	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ51815.1|GT66	0.0	1	743	1	741
QYS98817.1|GT66	0.0	1	743	1	741
UKZ88178.1|GT66	0.0	1	743	1	742
UKZ77637.1|GT66	0.0	1	743	1	721
UNI14722.1|GT66	0.0	10	743	9	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	0.0	19	742	13	718	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	4.20e-283	19	711	69	777	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	8.66e-260	16	713	12	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	1.74e-259	16	713	12	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	6.75e-257	16	708	12	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P39007|STT3_YEAST	0.0	19	742	13	718	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|O94335|STT3_SCHPO	0.0	22	729	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|Q3TDQ1|STT3B_MOUSE	1.20e-283	2	711	44	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|E2RG47|STT3B_CANLF	2.16e-282	19	711	69	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	2.16e-282	19	711	69	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000001

TMHMM  Annotations     

Start	End
21	43
85	107
119	138
142	164
176	198
213	235
242	264
274	296
303	325
362	384
391	413