CAZyme Information: TRIREDRAFT_120008-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_120008-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		64838.61	5.2174

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985057:170380-172250(-)

Full Sequence      

MGSAVDVFDYIIVGGGTAGLTVANRLTEDADIKVLVIEAGQDRTNDPLVQIPGLVVGMYG
KPEYDWNFSSTPQPGLNNRIINQARGKQLGGSSALNFMMMLYPPRGSLDAWGALGNKGWD
YDALSPYLSKFATFHPPPQAAKDAVGLGNHDDAAVGNGPIQVCFSEGYGKPNKAWMEAFA
HLGLDMKTDPRTGKGLGAFQQGGSIDPATNTRSHAASAHYTPEIASRSNLTVITETVVQN
IIFDASKDEPVAVGVLVRTRAGAEMTLLTDGEIILAAGALMSPQILELSGVGSKSLLQSL
GIPVLVDNPSVGENLQDHPITCQSFEVKPDVLSGDVLRDPNVLGALLQQFQDGGKGPLGQ
SNISVAYVPLANGAGVCSEDAKKSLFASHREHAQTPEAKMLCKLLQEQDEPAVQYFLFPS
QAHTVIDNPSSMADYLLPTSPENYLTVMTMLNHPFSRGSVHITSADVDELPRWDPNFNSN
PLDLEISGRHVQFVELLLRTAPFADLFKPGGARIPQLKGDTPDHAREVVRQSQVCCFHPC
CSLAMKPRETGGVVDSRLRVYGTKGLRVVDASVFPVQIAGNIQSMVYVVAEKAADIIKED
RLSK

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_120008-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	600	5.7e-177	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.87e-93	8	601	8	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.23e-88	8	598	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.25e-32	454	593	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.64e-27	77	320	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.47e-26	8	604	56	583	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS93387.1|AA3_2	0.0	1	601	1	600
UKZ84858.1|AA3_2	0.0	1	604	1	603
UKZ60559.1|AA3_2	0.0	1	604	1	603
UKZ74075.1|AA3_2	0.0	1	604	1	592
UKZ47512.1|AA3_2	0.0	1	604	1	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	6.54e-76	8	600	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	8.66e-71	8	603	6	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6O9N_A	3.09e-66	6	604	34	645	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	4.35e-60	8	601	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.28e-59	8	601	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2H3D1U1|ARMD5_ARMGA	8.35e-90	9	600	41	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.03e-84	8	600	14	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	3.03e-84	8	600	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	4.79e-81	6	600	12	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	9.52e-79	8	597	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999956	0.000094

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_120008-t26_1-p1.