CAZyme Information: TRIREDRAFT_112128-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_112128-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	GL985088|CGC2	58916.66	4.3358

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985088:56067-58016(-)

Full Sequence      

MAWSRAITYAALSSLLFRPANAERVWPDPKVDELEKLLYEQENPFDGPGGLASFVDGCSG
PAERALGIGRSFGAEWIRNAYHDMSTADVVAGTGGLDASIVFEMDRPENIGDAFQETLNI
FKGNYNKRVSMSDLFALATVMAVGGCSDGKVIVPLKGGRVDAAGPGPSGVPEPQQDLPTH
SASFAKQGFDTSEMIALVACGHTVGGVHGVDFPEIVPNPTPTDGSKNDNTVTFDSTTDYF
DNVVAKEFIANVSQNPLAFGQNETTRSDFRIFNADGGNMISQMATSNDFFLDTCNTMFES
MINTVPGNVKLTDINPLDVKPRKLTVTVNDDETLSVTGVIRVVDNLINGNGTRIIVHLSS
RSGDPLPGVEATTSRGQTGGCSYPNCGPSFTYYTFDSKIPSEHGISSFTVEIVDSQAGTN
SIHGNGGAGFPLPDDVLPMFSLSSQGAMTIDGISQMQLNLTAAVLNAERFTNVSLVVPQP
SNKSAPISPWTQEEVPMQPLSKVDGTNYTLYTGIWQSSGPTSAASTHPFDIVAMGPHGTV
SSLFNSWDDIPRH

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_112128-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	74	281	2e-23	0.7254901960784313

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	5.62e-104	26	303	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
395089	peroxidase	2.17e-19	62	208	5	155	Peroxidase.
173826	ligninase	2.21e-11	75	272	40	231	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173825	ascorbate_peroxidase	2.21e-10	77	240	34	190	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
272957	cat_per_HPI	1.21e-07	71	223	78	273	catalase/peroxidase HPI. As catalase, this enzyme catalyzes the dismutation of two molecules of hydrogen peroxide to dioxygen and two molecules of water. As a peroxidase, it uses hydrogen peroxide to oxidize donor compounds and produce water. KatG from E. coli is a homotetramer with two non-covalently associated iron protoheme IX groups per tetramer, but the ortholog from Synechococcus sp. is a homodimer with one protoheme. Important sites (numbered according to E. coli KatG) include heme ligands His-106 and His-267 and active site Trp-318. Note that the translation PID:g296476 from accession X71420 from Rhodobacter capsulatus B10 contains extensive frameshift differences from the rest of the orthologous family. [Cellular processes, Detoxification]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ86986.1|AA0	6.38e-250	1	552	1	549
QYT03617.1|AA2	1.15e-230	1	551	1	547
UKZ67466.1|AA0	1.60e-103	1	219	1	220
QRV79935.1|AA2	7.62e-79	21	536	17	513
QRW22025.1|AA2	6.64e-77	11	538	6	518

PDB Hits     

TRIREDRAFT_112128-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.30e-56	11	413	13	399	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	8.80e-11	77	218	118	259	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q7XZP5|APX5_ARATH	2.65e-08	64	208	21	164	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000321	0.999661	CS pos: 22-23. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_112128-t26_1-p1.