CAZyme Information: TRIREDRAFT_111849-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_111849-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		52845.08	5.9314

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985084:346861-348532(+)

Full Sequence      

MKSSISVVLALLGHSAAWSYATKSQYRANIKINARQTYQTMIGGGCSGAFGIACQQFGSS
GLSPENQQKVTQILFDENIGGLSIVRNDIGSSPGTTILPTCPATPQDKFDYVWDGSDNCQ
FNLTKTALKYNPNLYVYADAWSAPGCMKTVGTENLGGQICGVRGTDCKHDWRQAYADYLV
QYVRFYKEEGIDISLLGAWNEPDFNPFTYESMLSDGYQAKDFLEVLYPTLKKAFPKVDVS
CCDATGARQERNILYELQQAGGERYFDIATWHNYQSNPERPFNAGGKPNIQTEWADGTGP
WNSTWDYSGQLAEGLQWALYMHNAFVNSDTSGYTHWWCAQNTNGDNALIRLDRDSYEVSA
RLWAFAQYFRFARPGSVRIGATSDVENVYVTAYVNKNGTVAIPVINAAHFPYDLTIDLEG
IKKRKLSEYLTDNSHNVTLQSRYKVSGSSLKVTVEPRAMKTFWLEPQSTFAVI

Enzyme Prediction     

EC	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	28	463	4.6e-169	0.9932279909706546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	6.15e-27	5	469	6	433	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
307945	Glyco_hydro_30	5.08e-11	62	239	19	199	Glycosyl hydrolase family 30 TIM-barrel domain.
407314	Glyco_hydro_30C	2.27e-06	375	462	1	63	Glycosyl hydrolase family 30 beta sandwich domain.
396577	Glyco_hydro_59	1.05e-05	64	210	20	151	Glycosyl hydrolase family 59.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAV25955.1|GH30_7|3.2.1.-	0.0	1	465	1	465
AAP64786.1|GH30_7|3.2.1.-	0.0	1	465	1	465
UKZ57081.1|GH30_7	0.0	1	465	1	465
UKZ82812.1|GH30_7	0.0	1	465	1	465
QYT04915.1|GH30_7	0.0	1	465	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IUJ_A	3.46e-91	28	465	22	472	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	1.72e-90	25	465	92	543	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
6M5Z_A	6.31e-79	30	462	25	451	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	2.28e-78	30	466	5	449	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.98e-77	19	466	1	456	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	3.83e-79	6	466	3	473	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|Q45070|XYNC_BACSU	2.67e-13	125	462	102	418	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
sp|Q6YK37|XYNC_BACIU	8.45e-13	125	462	103	419	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
sp|Q9UB00|GLCM4_CAEEL	7.47e-10	20	416	78	508	Putative glucosylceramidase 4 OS=Caenorhabditis elegans OX=6239 GN=gba-4 PE=3 SV=2
sp|O16580|GLCM1_CAEEL	7.52e-10	125	406	182	481	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000565	0.999398	CS pos: 17-18. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_111849-t26_1-p1.