CAZyme Information: TRIREDRAFT_108348-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_108348-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585		63196.49	4.5736

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985066:1052099-1054072(+)

Full Sequence      

MPGSPLKTPVFLNNGEFFMEQSNVIQMNWPNVSDAFTKPVAMASASFSGWDWTRPWPGGD
VVDGHSVHLTVAPEVLTDPAVVVDATTVLSSLTFGIPDSMMSGGKALPMDPSWYICRHVF
ITTKPEAKKSADGGESCGFLEQACLDDLTTLLASGWGTADNNTMCAQLTFDPIPKSCGDS
FGYARQDSWSWGYSKKLDANARKTPKVTWTCISSGDAYVPPPPPPPPPSSTTTKPSPTPT
EIPKTDAYYDDFTAGLRQWTTFDGSFSSSSGVLVADYSLGGKALLKSSYSNFTFEADVTL
TNEWGNAGLIFRVSSPAEGADAYKGYYAGISTENNVVLGRASNDWTQISLVDVDIAANKA
HHLKVKVRENKIDVYVNDMTKAKISTTDSTYASGMDGVRVFDTGATFDNVQIFPLAFKDD
FVSGSMDKWISYGGDYATKNAALVGQASSGGKALIRNALYTDFVYEADVTIWDESGDAGL
VFRASSPYVETDGYYGYYAGFGNGYIVFGRSDNGWKELANVKASIQHGTAHHIMVRAKGN
AISIFVDDMNEPKVETEDGTYLTGLNGVRVSGTKTTFDNVVIYTM

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM66	256	410	6.1e-37	0.9806451612903225
CBM66	426	580	1.1e-32	0.9806451612903225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399445	DUF1080	3.89e-12	256	412	11	181	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ76854.1|CBM66	0.0	1	585	1	642
UKZ60433.1|CBM66	0.0	1	585	1	642
UKZ50510.1|CBM66	0.0	1	585	1	607
UKZ56147.1|CBM66	1.87e-243	6	585	5	642
UKZ81890.1|CBM66	7.67e-234	6	585	5	636

PDB Hits     

TRIREDRAFT_108348-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31411|SACC_BACL7	2.23e-07	279	416	256	390	Levanase (Fragment) OS=Bacillus sp. (strain L7) OX=62626 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000010

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_108348-t26_1-p1.