CAZyme Information: TRIREDRAFT_106575-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_106575-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: glycoside hydrolase family 79

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	GL985062|CGC5	49423.39	7.1096

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985062:1035839-1037685(-)

Full Sequence      

MLTHSALVALLGATSSVSAQVYTVPSQPNPKGEPLDGFVSYSIEFSSFPEFAGNKSSPNL
FSYNLINNLGALSGSKPYIRVGGNTQDYALYNASQETSLVGIVNPSRSPDYPTTIHIGPS
YFESYGTWPGVKFSHGFNLGLGGNRSEGWQTLSDTVPLACKALSHGNLYTWEYGNEPDLF
STSAQGPVRPSSWNESTYVWQWLNGTAEIKKQIVKHCPALALFGEPTFMAPSFAGTGNHL
KAIPAFQDGLDKNKNIEYFSTHNYISGATSPGVTLQGTLMNHTRTVGSVEGHLPEGTKAP
YYGSIAVAATLGNSALLPVSITNLPLPDAREAAYAAHYSSGLLRGHLARITVLNMRGYNT
TVDGQGLEPVPSPPPRPSQKYTFAVSGVRNGARVGVQRLLANGSDAITGITFDGWSYNYE
LDKGKPVRLHNVTVGETAVVRNGQVTVDVPDSSAVLLSFPLL

Enzyme Prediction     

EC	3.2.1.31:3	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	36	290	5.3e-48	0.5318681318681319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	7.25e-20	333	456	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ93451.1|GH79	3.03e-290	1	462	1	542
UKZ72593.1|GH79	8.36e-290	1	462	1	541
QYS95054.1|GH79	1.75e-289	1	462	1	542
UKZ45998.1|GH79	3.40e-289	1	462	1	541
UKZ70809.1|GH79	2.14e-283	1	462	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	6.17e-17	22	196	5	166	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SFB0|GUS79_NEUCR	1.25e-155	23	433	27	522	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1
sp|A2QEQ6|GUS79_ASPNC	7.81e-128	10	458	12	540	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000385	0.999586	CS pos: 19-20. Pr: 0.9647

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_106575-t26_1-p1.