CAZyme Information: TRIREDRAFT_105924-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_105924-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: glycosyltransferase family 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	GL985061|CGC1	53741.11	7.6952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985061:484124-485739(-)

Full Sequence      

MAPLISKKVLMITNIERGEINTFLATAAALKAANVALDLHLATFDGVQDALPEGVTYHQI
NGISMSEALQKHFLRTQGHANFPDSFTREPGFVNTQQAIKDAMSTSVPYTGPQMVDVFTS
IVSIIKDTEPDLIVVDSLMAAGLTACYHVGTKFICLGPTSIKTFAASSQPRAAGLWKFPA
PFSGFSYPVQWHQIPLNLFYAFSQVRALKKDNQRKDVQSYLNAHCVIRTPADLVDNRPEG
VKILVSSLPELDYPLKVPAHIIPCGPVVRAYAPLYKTNPKLAEWLANGHTILVNMGALVK
VSEAQAFEMAKALKTVIDRFDQNSEKKRIQVLWKLQKKGRYSIYAPECILAHVLGKEFAY
DRVRVVDWIQPEPLSILQTGDVICSVHHGGAGSFNEAVVTGVPQVVLPAWADNYDYAQRV
ELLGVGRCGNKTTKPHWTSGELSREMLDVLMGDSAAIIKEKAIILQHACQEKGSGAENAA
LAILHECSLL

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_105924-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.79e-25	79	485	51	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
215127	PLN02210	8.87e-14	261	483	225	450	UDP-glucosyl transferase
224732	YjiC	2.26e-12	360	489	283	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178170	PLN02555	1.01e-07	243	462	217	439	limonoid glucosyltransferase
273616	MGT	2.29e-06	363	480	277	383	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS93006.1|GT1	2.98e-226	1	489	1	490
UKZ74408.1|GT1	1.80e-217	1	487	1	487
UKZ47850.1|GT1	8.11e-210	1	487	1	481
UKZ84460.1|GT1	6.50e-206	1	487	1	487
UKZ60968.1|GT1	3.74e-196	7	487	6	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.52e-06	367	486	337	438	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.56e-06	367	486	357	458	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
4AMB_A	7.14e-06	362	480	289	393	Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMB_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4AMG_A	7.14e-06	362	480	289	393	Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMG_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_A Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_C Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_D Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	8.57e-54	9	442	8	430	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	1.35e-50	9	481	8	501	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|O22183|U84B2_ARATH	1.63e-10	261	478	212	427	UDP-glycosyltransferase 84B2 OS=Arabidopsis thaliana OX=3702 GN=UGT84B2 PE=3 SV=1
sp|M9MH90|EMT1_PSEA3	6.02e-08	361	490	441	565	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	2.42e-07	361	490	440	564	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_105924-t26_1-p1.