CAZyme Information: TRIREDRAFT_105557-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_105557-t26_1-p1
• CAZy Family: AA2
• CAZyme Description: glycosyltransferase family 34

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	GL985060|CGC3	53510.60	9.6283

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985060:1047637-1049132(-)

Full Sequence      

MSLSRSPSPVPGGGWSSPGLNINSGRSSPSNAAGSSVSWESAKMRKQGANGYPSFSTQNQ
GFFTRHMRRISSSLPRFAAGPGNTYAEREKYERGGHSPHAGGGRLRAFLARIGRRLKWRI
LLPLIIICTIVAYYGTHEAPGFVHWWRRISMGGGGEKFVIILGANVGGGVMEWKGAREWA
IERDSVRNKRKYATRWGYDLEIVDMKTKKRYAHEWRESWEKVDFIRAAMRKYPKAEWFWW
LDLNTYVMEPSYSLQRHLFNHLDRHVYRDINVFNPLNITHPPTEEYLDAEARSPVGDGNI
NSVNLMLTQDCSGFNLGSFFIRRSAWTEQLLDIWWDPVLYEQKHMEWEHKEQDALEQLYR
TQPWIRQHTGFLPQRLINSFPPAACADESGLNNTRIHYNEKDRDFVVNMAGCEWGRDCWG
EMYHYREFSYWLNRNPWELFKEEIVAVIWYKLTGQRVKL

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_105557-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	156	420	1.5e-85	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	2.80e-80	156	418	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	1.01e-05	219	334	183	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ51376.1|GT34	0.0	1	459	1	457
QYS98472.1|GT34	0.0	1	459	1	456
UKZ87857.1|GT34	0.0	1	459	1	458
UKZ77201.1|GT34	8.88e-275	44	459	1	391
UKZ62923.1|GT34	3.29e-251	1	382	1	381

PDB Hits     

TRIREDRAFT_105557-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	3.33e-102	157	440	121	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	1.12e-84	156	426	73	331	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	2.27e-24	183	412	125	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.96e-23	156	418	102	339	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	9.11e-19	186	412	112	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_105557-t26_1-p1.