CAZyme Information: TRIREDRAFT_104121-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_104121-t26_1-p1
• CAZy Family: AA11
• CAZyme Description: glycosyltransferase family 58

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		47826.77	9.8040

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985058:215818-217321(+)

Full Sequence      

MASLIKTAVDIANGRHALSRYVIFGLWLADAVLCGLIIWKVPYTEIDWVAYMEQVTQFVH
GERDYPKMEGGTGPLVYPAAHVYIYTGLYYLTNKGTDILLAQQLFAVLYMATLAVVMTCY
SKAKVPPYIFPLLILSKRLHSVFVLRCFNDCFAAFFLWLCIFFFQRREWTIGALAYSIGL
GVKMSLLLVLPAVVIVLYLGRGFKGALRLLWLMVQVQLLLAIPFITTNWRGYLGRAFELS
RQFKFEWTVNWRMLGEDLFLSRGFSITLLAFHAIFLLAFILGRWLKIRERTVLGMIPYVI
RFRSPFTEQEERAISNRVVTPGYVMSTILSANVVGLLFARSLHYQFYAYLAWATPYLLWT
ACPNLLVVAPLWAAQEWAWNVFPSTPLSSSVVVSVLAVTVAMAFAGSNPQPRETSKPKQH

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	26	389	3.5e-144	0.989010989010989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	26	383	3	352	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT02043.1|GT58	1.81e-273	1	419	1	418
UKZ54160.1|GT58	7.36e-273	1	419	1	418
UKZ79942.1|GT58	2.11e-272	1	419	1	418
UKZ93067.1|GT58	5.25e-256	1	419	1	424
UKZ66204.1|GT58	7.61e-251	1	419	1	423

PDB Hits     

TRIREDRAFT_104121-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	9.07e-179	8	410	22	425	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	1.32e-131	13	400	13	388	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	5.88e-129	13	420	75	470	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	1.57e-126	26	420	32	417	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	8.24e-122	13	420	13	409	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000009

TMHMM  Annotations     

Start	End
21	43
98	120
141	163
178	200
207	229
263	285
349	371
386	408