CAZyme Information: TRIREDRAFT_103995-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_103995-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	GL985057|CGC1	60429.28	5.3146

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985057:1891183-1892946(+)

Full Sequence      

MPLQQVLAAALLGFGAVTPVHAQGRGDWQAPLPDYYADICPDYALYSTYPHRPYSSGPHA
LPYQRPNPRCRTFQSDEIERVIEEVTSRIKDPDLARLFENAFPSTTDTTVKFHTKGGKDA
GFVPVQGPPLEDGAWEGPQSFIITGDIVAEWLRDSTNQLRPYQALAKKDPAIFDLIVGAI
NTQSEYVIQSPYCNAFQPPPISDLSSTANGQDDVVHPAYEPSVVFECKYELDSLAHFLAL
ANDFYDHTGATDFMTKRWLRAVETLLVVLEQQSEPTFNPKTGQYERNAYTFQRWTNAGTE
TLNLQGVGNPLNSGTGLVRSAFRPSDDATILGFFIPANAMMSVELGRAAKMLQAARNKAL
AAKMSQWSEKLRAGVLEHGIVKHKKYGDVFAYEVDGYGSSILMDDANYPSLLALPVMGFC
DVDDPVYQNTRKMILDKQGNPYYLKGKDFHGIGGPHIGLKNAWPMSLLLQAQTSNDDDEI
KQCLDLVLNASPRGLIHESVDVNYVSQYTRSWFAWANGVFAVTILDLAKRKPHLVFGPGA
APYEM

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_103995-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	91	525	1.2e-162	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	91	525	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.67e-171	70	534	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
225922	SGA1	1.46e-05	331	533	412	612	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT04109.1|GH125	0.0	6	545	5	540
UKZ56404.1|GH125	0.0	1	545	1	541
UKZ64614.1|GH125	0.0	5	545	4	541
UKZ90116.1|GH125	0.0	5	545	4	541
UKZ64615.1|GH125	0.0	52	545	33	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	3.34e-93	65	527	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	1.49e-90	65	527	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	2.78e-90	65	527	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QPF_A	4.14e-73	73	526	3	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
6RQK_A	4.03e-72	72	531	5	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	6.87e-188	40	535	27	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999699	CS pos: 22-23. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_103995-t26_1-p1.