CAZyme Information: TREMEDRAFT_73633-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_73633-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680		73152.64	4.0345

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711531:483124-485356(-)

Full Sequence      

MSIFATLAALSLSLSFSVLPVIAQNVTSYAISPAPFTDLCVAPSSSSEGAQLVLTNCNDD
LVAWTYSAGSLVNTATNMCLDLTDGGAWSGNKLQVWGCYSWNPNQQWDLSGENIKWDGQN
LCMDLTDGDGSDGTVLQVWQCYDGNSNQEWVFTEIEEVGDDDECVTASPSGPTATASTAS
SSTASPSFIADAVNATDLLATPTASATADSASDTTSVIGGELWGNGGGNNHTSSSSASDS
WNTGGSSDSWGSSTSASWASATASATFTSSSASSSSTSSSSGSVSNSGILQTSGTKIVDP
SGNEVVLRGVNIGGWLVLEDWMCGINDNSGSGDRFAQDTLENRFGVDATAALIETWQDNY
MVESDFDNIAAMGFNVMRMPFSYRTVQWANGSWRDDAFTKMDWAIAQGKKRGIYCIPTFH
IWDSQKDDYSLISEDSDGGQSSRDAAGEIWKKVAAHWMGETAIAAYDAINEPTGSAGDKL
QQDLYNAIRSVDANRIIIMESISTDPSTYGWTQVVYSMHEYLMMTDDVGANQAAWSGAQG
DIDTWNGYQIPTYIGEFMAHEDTLPYMLDQLNNNRVSWSFWSYKSVNMGGWSVYIFPANP
VDVSNDDYNSIMNAWSNFGTPTQNSDIYQTYVNAAGGNANLKKREERFVKVSQRAGAESA
RRSWGSHRRAGRFSSHGRSK

Enzyme Prediction     

EC	3.2.1.39:5	3.2.1.14:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	339	584	2.1e-52	0.9961977186311787
CBM13	29	157	1.9e-18	0.6968085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	3.37e-17	29	152	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395098	Cellulase	7.71e-17	363	583	27	268	Cellulase (glycosyl hydrolase family 5).
395527	Ricin_B_lectin	1.54e-16	67	154	1	86	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.89e-16	36	150	9	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.57e-11	75	154	8	84	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOH79756.1|CBM13|GH5	6.95e-167	27	646	28	753
AFR92930.1|CBM13|GH5	2.44e-164	27	646	28	753
AUB22412.1|CBM13|GH5	2.44e-164	27	646	28	753
AAW41305.1|CBM13|GH5	8.11e-162	27	667	28	826
ADV19959.1|CBM13|GH5	1.13e-152	27	667	28	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3N9K_A	1.43e-09	306	599	13	380	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
3O6A_A	1.90e-09	306	599	13	380	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	2.47e-09	306	599	8	375	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
4M80_A	2.52e-09	306	599	13	380	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
2PF0_A	3.35e-09	306	599	14	381	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	1.06e-22	290	590	4	344	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A1CRV0|EXGA_ASPCL	2.20e-14	306	599	41	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|A1D4Q5|EXGA_NEOFI	1.21e-12	306	601	41	401	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	1.21e-12	306	601	41	401	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	1.61e-12	306	601	41	401	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999779	CS pos: 23-24. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_73633-t26_1-p1.