CAZyme Information: TREMEDRAFT_68105-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_68105-t26_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	JH711530|CGC1	48524.24	8.9177

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711530:728326-729963(-)

Full Sequence      

MVRSLLLDRQYFWYLFSLLFVGEALLGLLIINKVAYTKIDWVAYMQQVDGFIFGERDYSK
LEGETGPLVYPALHLYIYAALHQLLPNDRVRAAQYIFLLVYLVTFTLVGCIYYFCGSRNR
HIPQILLVPLTLSKRAHSVYLLRLFNDPLTMILLYAAVVGFMCRTTTGWRVGSVLFSMAL
GVKMNILLFLPGLLVLLVQYRGIFGTLESTAIMASIQVRNVIASPSLFFITALPFLAHDS
LAYFNSAFDFSRQFLYKWTVNWRFISESTFLSKEWATGLLMGHLTILMIFAAYRWAPNPV
TLLHQACSTPQTTITEIPLVLFTSNLIGMTFARSLHYQFHVWYFHQIPLLLYLGGAWGNP
ILGPCLWIMIEYAWATAPSTNFSSGILFFSHIVMLGGLLLHTKPIFNDLSSSEITLASTR
RENEAT

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	18	384	5.6e-121	0.9917582417582418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	5.59e-151	17	384	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW46504.1|GT58	9.23e-157	1	401	24	433
AFR94407.1|GT58	1.06e-155	1	401	24	433
AUB24060.1|GT58	1.06e-155	1	401	24	433
KGB78711.1|GT58	4.29e-155	1	401	24	433
ADV21666.1|GT58	3.48e-154	1	401	24	433

PDB Hits     

TREMEDRAFT_68105-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CN93|ALG3_CRYNB	1.64e-157	1	401	24	433	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ALG3 PE=3 SV=1
sp|P0CN92|ALG3_CRYNJ	1.64e-157	1	401	24	433	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ALG3 PE=3 SV=1
sp|Q8K2A8|ALG3_MOUSE	2.49e-86	5	395	35	417	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2
sp|Q92685|ALG3_HUMAN	3.77e-82	3	404	33	426	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1
sp|Q55F69|ALG3_DICDI	9.81e-78	12	409	18	430	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000000

TMHMM  Annotations     

Start	End
12	31
92	114
139	161
176	198
218	237
275	297
318	337
347	369
382	401