CAZyme Information: TREMEDRAFT_67696-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_67696-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		39305.81	6.2781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711529:1239304-1240693(+)

Full Sequence      

MSEPKPIPPPRYPGLILTSCLEDNPAPHTLKLLEKLCKNYIGSDEVFSVTYSPLLCPEGK
NYLYTLKPYWWEVEPGHWDCELPQGQNQLQKASMAIHTLALGSKYLPYLADQCSKQAENL
LRYFFINHDTRMLPEILYAQCNPSSSPLRGDQAFVIAVKLLDDLKTWFRNHLDWMATSEQ
GAMARAYGNNITIWYHALVATHLSLVNPPEAAVYSLTALQEIHARHTTPESFFSREVSRT
RPRHYTLFTLEPVFLLSSQTGKIPPDNVYGYLRDLVEYARHVMGSPIEIEVDDDPRYFAK
LEWFETMLKRWSGQSKKTEEPDGTQWDGGWNQFARLLWGFI

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_67696-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	162	260	4.8e-18	0.3548387096774194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	3.45e-15	72	252	41	231	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOL13033.1|PL38	5.87e-13	48	271	77	332
QUE53296.1|PL38	7.93e-13	59	271	34	275
QCX01958.1|PL38	8.85e-13	59	274	60	303
ATO31247.1|PL38	1.39e-12	48	271	69	324
QVH51113.1|PL38	1.42e-12	48	271	77	332

PDB Hits     

TREMEDRAFT_67696-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TREMEDRAFT_67696-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000088	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_67696-t26_1-p1.