CAZyme Information: TREMEDRAFT_66619-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_66619-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		52990.05	5.0068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711571:31-1810(-)

Full Sequence      

MEDDWEDFPFDDNSSNSDGGNDDDTKQQEEYIIVNGDHYFPHHIPSNIPPFTPHPTSLPE
PNTILPEIDLENIRPPKENPFPENELDEVLSSTQEEVTGTGYYVSEDSWARNWEKPKVWD
EERGEIRKVQWEGFDGIGTEVEDVKHGGKGGKGGKGNEERMKKWRESKKRRKLREERKQA
VRRGFIHAWQGYKDHAWGHDEVKPVSQQPSNPFNNWGATIIDSLDTLLLLGFPEEYTLCR
PHINQLNFHWISGRDWRHPYISPTLVVPTTDPDSSSQPLTIHRDHNIGLPVFETGIRYLG
GLLGAYDLTGDQLLLDRAIDLAHILGRAFDTDSGLPAGRIDPGSPGGFRLGSVSAAEVGS
MTLELIRLSQITKDRQWFDLSQRAIDFIENRIIPRVLHPPLVPLWFTPNSPFSQQLNGAI
SFGGLADSYYEYLIKTYKLLGGTTVSKQYSKLYSDSIDTARKVLLYG

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_66619-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	185	466	3.7e-69	0.5560538116591929

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	9.41e-90	185	467	2	252	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.34e-65	166	465	61	324	glycoside hydrolase family 47 protein; Provisional
271199	LanC_SerThrkinase	2.24e-04	301	387	94	174	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
271200	LanM-like	4.01e-04	299	394	598	689	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR96466.2|GH47	1.35e-144	31	464	106	509
AUB26389.1|GH47	1.35e-144	31	464	106	509
UOH82871.1|GH47	2.62e-144	48	464	110	496
ADV23425.1|GH47	5.19e-144	31	464	106	509
CAY09771.1|GH47	6.37e-142	48	464	123	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.88e-32	177	463	5	250	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	1.96e-32	177	463	5	250	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	2.04e-32	177	463	10	255	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.09e-32	177	463	10	255	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	4.88e-32	177	463	88	333	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H116|MNS2_ARATH	5.84e-35	176	458	97	343	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	1.89e-32	176	457	96	342	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	6.12e-31	177	463	249	494	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|D4AV26|MNS1B_ARTBC	1.22e-30	176	437	39	276	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	5.76e-30	177	437	40	277	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_66619-t26_1-p1.