CAZyme Information: TREMEDRAFT_64687-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_64687-t26_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	JH711538|CGC3	55006.87	6.0876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711538:1004400-1006511(-)

Full Sequence      

MFNVNSKRSYVPLPSSFASTSSFPNQSILPLIQITEKPDPESDPPLLTEERPQWLRWILN
FLRQIKTSISRISPRIRLLLFSMIIFSIILSSQHRISSSKIGLRPSKPTSYSGSSTSSSS
SSMLGIENESEVKEAYVTFLSPGDDNYFTSVRLIVFALLHDPITLDPATSSCPPLPSSSI
SSATTAISENSLTSDDKIELAPIPRSSTSNSEVDMSRRRYIPELDPTSHSAPLEPPTKRS
WWPFSSSSSHQPKCGPRRDIVVLTSPNVPKHQISTLQNEGAIIIPSQDLEKGSIEHMPEH
WKHALTKLAVFNMTQYDRLLLLDGDIFLNLDLRGVWEDEHSWPKSGLAATGDGGAGFGGW
HEVPQSNEGDFNSGFMIVIPNRTTFEELLKVEDYDHGWADQRNTGEGMGRGLLNVYFHPE
GPHPWEQLDHKWVGNYPGVRELEYGINALHEKLWRGSDRNDLPEELRSLWERRVGRMEGY
WLSHRPIGL

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_64687-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	256	433	5.2e-16	0.6770428015564203

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	5.11e-21	257	431	29	179	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.04e-07	260	454	105	336	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	1.70e-05	284	432	62	211	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133064	GT8_GNT1	7.52e-05	255	331	27	109	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB24108.1|GT8	3.92e-51	132	483	82	334
AFR94449.2|GT8	3.92e-51	132	483	82	334
ADV21646.1|GT8	7.67e-51	132	483	82	334
KGB78674.3|GT8	7.67e-51	132	483	82	334
AAW46475.2|GT8	2.09e-50	258	483	123	334

PDB Hits     

TREMEDRAFT_64687-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43062|YGT9_SCHPO	2.11e-15	250	477	104	367	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|O43061|MU136_SCHPO	5.08e-14	260	489	105	371	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q09680|YA0C_SCHPO	2.21e-10	250	477	98	362	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999912	0.000126

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_64687-t26_1-p1.