CAZyme Information: TREMEDRAFT_63970-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_63970-t26_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633	JH711536|CGC4	73164.64	7.4352

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711536:910148-913478(-)

Full Sequence      

MFRLRASRATLFLSFLLVLAASLIFLSPHGHLTPSHDDPAHPPFDLGLSGQNSWLNFISQ
SSSALFQSVADLPGLQYGTDGLVRGWEDVHELVEHGGVGLKKKDRKRLKEVRDRHPIETL
IELGKQRWETLLARQSKTLPQAVTEYTRRYNRAPPKGFEEWWQFCKRNKVRIVDDYDQIN
RDIEPFLALSPELFRRRLIIRRVDLSPTTESILSGERAVSVRAKALFNLLEPIAQYFYTD
VTFYGSDHDMGKNLLGDDQRQAALEAVREGRFLTEMDLKGYEKTQGRVAVGGLASACPEG
SPAWNRSLDIQEGRMVGPLTERETTFIYDHQTASDFCVHPRLTHLHGALSFDTPRDTVLR
PLFQYSKLSLNPEFLTTPLEAFANLSSSAAQEKYSPWEEKTVNKLFWRGSGTGDAYSKRK
NYNWRQSHRTRLALMAQRRDGDEEVWVKRGREWEKEKWGVGKLNEAYLDVGMSGKPHQCK
QEDGTCDEMASEIKFLDRVPQEKAAQYKYVFDVDGNGWSSRFHRLLSSGSVVLKSTIYPE
WYSDWMIPWYHYIPCKVDYSDIYHIMSFFSGSPEGRVAGRDDLAREIAMHGREFTEEFWR
WEDMQAYMFRLLLEYARLTAPDRQTASYHKSYT

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_63970-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	358	619	3.3e-68	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.95e-27	396	618	79	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.66e-15	499	618	208	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAV28771.1|GT90	3.50e-268	3	633	4	641
ADV24227.1|GT90	3.50e-268	3	633	4	641
AEG78614.1|GT90	3.29e-266	3	633	4	641
AAS92531.1|GT90	6.62e-266	3	633	4	641
KGB79935.1|GT90	6.62e-266	3	633	4	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.44e-10	506	617	236	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.54e-101	115	623	152	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	9.10e-11	506	617	264	368	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	8.85e-10	506	617	264	368	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.18e-09	506	617	264	368	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	1.63e-09	445	624	306	472	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.964950	0.035080

TMHMM  Annotations     

Start	End
9	26