CAZyme Information: TREMEDRAFT_63504-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_63504-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	JH711535|CGC6	68909.01	6.2129

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711535:566432-569523(+)

Full Sequence      

MRDIDRFSTRYSGVRVKKEKMEELVHLVVCPISAWGHLRPLFTLLSHLSHVHPQIRITVL
SVPSVIPRIKHDLQKERWDYTSVPPLLAQELIQRRESFLNKLRFIGLEKDRGVMNQMWDP
KTMDRQAEEFGELLEDVLVELLDQETGGKPHLNDSGDVIVNQERRGLFILIAVRTTKRID
HSGYEIEREEQWPKPKLFIYDGFQVGFIPALEAATKRLRIPNRPKTMLFFPCLVSWAANC
WATVEEGSDLARAVEKTDRIKIATGLDEAEAMGIAFSTFTNDIIKTPGLDPIYDHEYYQC
YRSLSSGVYEVDRAQNRMLSSLDPQFHSIHSLPSLMAVRRSLWHQREYCDGFIFSWDPEL
EPEAREAFQRSTGKSCWPMGLQLAPEIWEGVLPRVDEQGEKIVRWLDHVKDVRGSGSVLY
ICFGSLFWPMRRPDLIETLLKGLVSNDQPFILFASAPNSLVTEEMRDVVNHYEWGYMKEG
FGPQDLVLKHDAVGFFLSHMGTNSVAESILAGKPFLCMPYLGDQPDMTQRNSQKTFDGQS
ILNTPEAVLTELAQVLGRIRGEEGLRMRENVIKLRERIIKSWREGGARNMIESFCDNWA

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_63504-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	358	530	6.1e-18	0.35602094240837695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.73e-22	269	530	118	345	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
178032	PLN02410	4.09e-16	322	594	168	444	UDP-glucoronosyl/UDP-glucosyl transferase family protein
177813	PLN02152	3.67e-14	360	595	208	455	indole-3-acetate beta-glucosyltransferase
177830	PLN02173	5.93e-14	405	594	257	442	UDP-glucosyl transferase family protein
178572	PLN02992	3.31e-13	287	595	146	461	coniferyl-alcohol glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96365.1|GT1	7.45e-28	26	587	7	513
VWP02307.1|GT1	2.24e-27	26	586	7	518
VWO96367.1|GT1	2.65e-26	153	587	19	449
VWP02304.1|GT1	2.79e-23	271	596	188	495
ABK24936.1|GT1	1.01e-20	351	587	227	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PQ6_A	8.34e-15	359	590	236	468	Crystal structure of Medicago truncatula UGT85H2- Insights into the structural basis of a multifunctional (Iso) flavonoid glycosyltransferase [Medicago truncatula]
3WC4_A	9.55e-15	353	576	210	420	Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase from Clitoria ternatea [Clitoria ternatea],4REL_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with kaempferol [Clitoria ternatea],4REM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with delphinidin [Clitoria ternatea],4REN_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with petunidin [Clitoria ternatea],4WHM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with UDP [Clitoria ternatea]
6LZX_A	1.89e-12	351	587	238	488	Structure of Phytolacca americana UGT3 with 15-crown-5 [Phytolacca americana],6LZX_B Structure of Phytolacca americana UGT3 with 15-crown-5 [Phytolacca americana],6LZY_A Structure of Phytolacca americana UGT3 with 18-crown-6 [Phytolacca americana],6LZY_B Structure of Phytolacca americana UGT3 with 18-crown-6 [Phytolacca americana],7VEJ_A Chain A, Glycosyltransferase [Phytolacca americana],7VEJ_B Chain B, Glycosyltransferase [Phytolacca americana],7VEK_A Chain A, Glycosyltransferase [Phytolacca americana],7VEK_B Chain B, Glycosyltransferase [Phytolacca americana],7VEL_A Chain A, Glycosyltransferase [Phytolacca americana],7VEL_B Chain B, Glycosyltransferase [Phytolacca americana]
5U6M_A	2.12e-12	403	587	255	434	Crystal structure of UDP-glucosyltransferase, UGT74F2, with UDP and salicylic acid [Arabidopsis thaliana],5U6M_B Crystal structure of UDP-glucosyltransferase, UGT74F2, with UDP and salicylic acid [Arabidopsis thaliana],5U6S_A Crystal structure of UDP-glucosyltransferase, UGT74F2, with UDP and 2-bromobenzoic acid [Arabidopsis thaliana],5U6S_B Crystal structure of UDP-glucosyltransferase, UGT74F2, with UDP and 2-bromobenzoic acid [Arabidopsis thaliana]
5V2K_A	2.12e-12	403	587	255	434	Crystal structure of UDP-glucosyltransferase, UGT74F2 (T15A), with UDP and 2-bromobenzoic acid [Arabidopsis thaliana],5V2K_B Crystal structure of UDP-glucosyltransferase, UGT74F2 (T15A), with UDP and 2-bromobenzoic acid [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|U5NH37|7DLGT_CATRO	2.52e-15	397	587	279	465	7-deoxyloganetic acid glucosyl transferase OS=Catharanthus roseus OX=4058 GN=7DLGT PE=1 SV=1
sp|U3U992|UGT8_CATRO	2.52e-15	397	587	279	465	7-deoxyloganetic acid glucosyltransferase OS=Catharanthus roseus OX=4058 GN=UGT709C2 PE=1 SV=1
sp|Q6VAA9|U73E1_STERE	8.23e-15	351	524	225	398	UDP-glycosyltransferase 73E1 OS=Stevia rebaudiana OX=55670 GN=UGT73E1 PE=2 SV=1
sp|P14726|UFOG_HORVU	1.64e-14	358	596	221	450	Anthocyanidin 3-O-glucosyltransferase OS=Hordeum vulgare OX=4513 GN=BZ1 PE=3 SV=1
sp|Q9LFJ8|U78D2_ARATH	2.96e-14	357	576	230	433	Flavonol 3-O-glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGT78D2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_63504-t26_1-p1.