CAZyme Information: TREMEDRAFT_63477-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_63477-t26_1-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771		85559.36	4.1416

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711535:476994-480841(-)

Full Sequence      

MSVLDSKKAHYLVVPISGWGHLRPMLQFSLNLLTVRQDLTVTLLMDRATAPRLAHALACN
LSGEDVLCRLKTKQIEEPAPTESEKADHLRPPKGGSTKEIIEVFQESDPPTLVIYNWLGV
HFLDSFKPVINQLQLSSLPVYVFCPLISGSLYHFMAKKEHDGMIATFFEETEKLMDQGVE
KYEAYDKTWYKFEDKIIHIPGYPPMKDWECFPQNEGIPFPARWSEFIKQSYDALSDPLLK
GVLIPSAPELEGEPQEALGKDLGKRIIGIGPQFSADVWDGIPPSMTRSTPDEVEALDFLD
EQLKLKGPRSVVYISFGSVFFPIHRPEIMPMLLKSLPSNMTFLLANAGDMSNLTPETAAE
WVEGGRGKVVKFAPQWKVLNHPAIAWFISHMGINSSQESIMAGIPVVAFPQAADQNESAM
LLGKLGTCIELQQLRTANGLTRANGTTIISTHESMLKEMHETWEVMQRDSDLMRQKAKEA
REILVRSWKQGASRKNMEEFGRMDYGFYCYTTPLHINLTLLIFIRFLDTYMWTSVLGRVS
LNLEDNPNIGWRVHFLIKNVMIVGEAKGEVVFCPSFPLLSINITFGRPDGGTMRGVVDVL
ADEEALADELSAEEGALAEEMAEEDALADELAAEDALADELAAEDALADELAAEEGAPAE
EMVEEEALAEEFADEALAEGRLEEAELLAEAEDAEESADKAEEAEAELLADAEVEAELFA
PLDADTEIEIEELAGIEVEIEELALCPGTGGGVELGPELELELKLEEKEVL

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_63477-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	259	430	3.6e-19	0.4031413612565445

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.00e-25	9	443	1	368	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
178170	PLN02555	4.37e-22	218	500	196	463	limonoid glucosyltransferase
215127	PLN02210	8.23e-22	1	422	1	381	UDP-glucosyl transferase
215247	PLN02448	4.24e-20	10	503	12	454	UDP-glycosyltransferase family protein
178032	PLN02410	1.09e-17	213	500	165	444	UDP-glucoronosyl/UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE72247.1|GT1	3.15e-31	4	463	1	459
QRW25636.1|GT1	1.09e-28	10	461	8	455
QRW23591.1|GT1	8.60e-28	3	459	1	454
QRW23592.1|GT1	2.68e-27	3	459	1	451
QRW23583.1|GT1	9.07e-27	5	459	3	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ACV_A	1.24e-15	1	424	1	391	Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula],2ACV_B Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula]
2ACW_A	1.26e-15	1	424	1	391	Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula],2ACW_B Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula]
5V2K_A	8.44e-15	4	493	1	434	Crystal structure of UDP-glucosyltransferase, UGT74F2 (T15A), with UDP and 2-bromobenzoic acid [Arabidopsis thaliana],5V2K_B Crystal structure of UDP-glucosyltransferase, UGT74F2 (T15A), with UDP and 2-bromobenzoic acid [Arabidopsis thaliana]
5U6N_A	8.44e-15	4	493	1	434	Crystal structure of UDP-glucosyltransferase, UGT74F2 (T15S), with UDP and salicylic acid [Arabidopsis thaliana],5U6N_B Crystal structure of UDP-glucosyltransferase, UGT74F2 (T15S), with UDP and salicylic acid [Arabidopsis thaliana],5V2J_A Crystal structure of UDP-glucosyltransferase, UGT74F2 (T15S), with UDP and 2-bromobenzoic acid [Arabidopsis thaliana],5V2J_B Crystal structure of UDP-glucosyltransferase, UGT74F2 (T15S), with UDP and 2-bromobenzoic acid [Arabidopsis thaliana]
6LG0_A	1.18e-14	223	483	195	438	Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_B Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_C Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_D Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_E Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_F Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1V0QSE8|ERIJ_HERER	5.59e-32	4	463	1	459	UDP-glycosyltransferase eriJ OS=Hericium erinaceus OX=91752 GN=eriJ PE=1 SV=1
sp|Q6VAA6|U74G1_STERE	3.79e-18	7	442	9	405	UDP-glycosyltransferase 74G1 OS=Stevia rebaudiana OX=55670 GN=UGT74G1 PE=1 SV=1
sp|Q66PF4|CGT_FRAAN	1.43e-17	197	422	172	391	Cinnamate beta-D-glucosyltransferase OS=Fragaria ananassa OX=3747 GN=GT2 PE=1 SV=1
sp|V5LLZ9|GGT_QUERO	1.58e-17	197	422	172	390	Gallate 1-beta-glucosyltransferase OS=Quercus robur OX=38942 GN=UGT84A13 PE=1 SV=1
sp|Q9MB73|LGT_CITUN	1.59e-17	197	422	172	391	Limonoid UDP-glucosyltransferase OS=Citrus unshiu OX=55188 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_63477-t26_1-p1.