CAZyme Information: TREMEDRAFT_63041-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_63041-t26_1-p1
• CAZy Family: PL14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		53497.16	10.1641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711534:261520-263388(+)

Full Sequence      

MGNTPSNSNSPSRSNLDRPSPNDRRSSSRQPNLRLPMPSRPPSLSPTSSNPTSPSGRSNS
PRRRKSLELPDLNRLAFTPAAAPVVTIATHTSHLQPTGHTKRPSDVAATSVPSRSGSRRW
PAGLGTRSPLGGMGLSPMSKLDANAPMSAPVVMPNPSVSPSRATSTSDNPFFPTSPLSKD
SDGRGVSPNRAMPIPIPGKGTDSGVRKSQMANLTPPRSGMTAPEKSTTQTPSEPVEEEQA
NDGLVAVPIQWTQGGRNVFVTGTFADNWKNRIPLRKSTHDFNTVLRLAPGEYRLKFIVDD
GWRCSKSIPTATDSDGTLVNYIEVEPLKTVEDEKAEWAMAVKPTIKEEDDSKWTNIIPPS
LTLYQYLEELPSTFTSREAANSYFQSVPYLSPVPQPPMLPRILERVIVNGEPRHPDDPRG
TGMIASQMPAGHDDNSILAVPNHVVLNHLTASAIKNGTLGVGTTTRYRQKYITTMFFKPT
QQDLHQDQVTPM

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_63041-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	2.27e-38	245	326	1	81	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199889	E_set_AMPKbeta_like_N	4.96e-25	247	324	2	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
214973	AMPKBI	3.18e-24	364	479	5	99	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
398422	AMPKBI	3.44e-24	394	479	1	69	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
223021	PHA03247	9.36e-05	18	246	2625	2857	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22772.1|CBM48	1.33e-108	1	478	1	490
KGB76162.2|CBM48	1.50e-103	169	478	25	331
AFR95838.1|CBM48	6.45e-103	1	478	1	490
AUB25695.1|CBM48	6.45e-103	1	478	1	490
UOH82189.1|CBM48	9.10e-103	1	478	1	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QLV_B	2.79e-32	244	479	3	251	Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae],2QLV_E Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae]
7JHG_B	1.37e-26	249	479	7	197	Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JHH_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JIJ_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7M74_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens]
4REW_B	1.84e-26	249	479	6	196	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
4RER_B	9.05e-26	249	479	6	196	Crystal structure of the phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex bound to AMP and cyclodextrin [Homo sapiens]
6B2E_B	4.98e-25	249	479	81	271	Structure of full length human AMPK (a2b2g1) in complex with a small molecule activator SC4. [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78789|AAKB_SCHPO	1.21e-32	218	478	73	294	5'-AMP-activated protein kinase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=amk2 PE=1 SV=2
sp|P34164|SIP2_YEAST	2.55e-30	244	481	163	413	SNF1 protein kinase subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIP2 PE=1 SV=3
sp|Q04739|GAL83_YEAST	2.46e-27	235	481	152	417	SNF1 protein kinase subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAL83 PE=1 SV=1
sp|Q6PAM0|AAKB2_MOUSE	5.23e-25	249	479	80	270	5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1
sp|O43741|AAKB2_HUMAN	5.34e-25	249	479	81	271	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_63041-t26_1-p1.