CAZyme Information: TREMEDRAFT_61657-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_61657-t26_1-p1
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	JH711531|CGC3	61196.87	5.8797

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711531:609855-612422(-)

Full Sequence      

MLPTIHIHASSDPGPSKLFSLPSISLFRSSEKQPSISSTSVNMSIGHSGAILPGAPHLPL
RRRRMVTQGVAVTALLSLCLLWFTGGAGMGTLLAPPKPDWTVEQIPPGRVIDPEIAAHLG
KPKGPPEFTGYPIPSPDLSLWGLDLRSDRLLAGISPWPPNPAVEESQPALSSLGHFADNI
YKHGPLDLETYSTQLREFAEVAFPRNIAEELKKGIEMYLGEGRGDKEIDENVPGPEAWDK
QKFMWQTDKDERREQSVTVASWTGRTMKDEGWNWELMTDQEADQWMRKKLPDSRIELMWT
SLPTGILRSDMIRYLLLLIHGGIYSDTDTALLKPPSDWGKGARLWRDGLGWIGDADKARI
DAGEEVDDVIGKPSVVVGIEADVGDRSDWYEWWPRPIQIVQWTMASAPYHPICLQALLRI
LHSTAHAVQWSHEHRRNLKALTDLGMFREVSSLREVTVLSEPKGGGPVGVMAWTGPGVWT
DAVLSYIRVRYGVQWTDLRELKEPLRIGDVMVLPVTGFSPGVGNFGSEPAWHPQAMVEHK
FEGSWKNAIP

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_61657-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.18e-12	242	548	84	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.99e-11	292	345	40	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75350.2|GT32	1.49e-183	56	547	49	571
AAW41222.1|GT32	3.61e-179	47	547	45	571
ADV19938.1|GT32	1.40e-178	56	547	48	570
AUB22355.1|GT32	4.72e-177	56	547	50	571
AFR92874.2|GT32	4.72e-177	56	547	50	571

PDB Hits     

TREMEDRAFT_61657-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.93e-41	242	547	144	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.66e-33	229	547	94	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	9.58e-33	244	546	100	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	6.95e-18	299	519	189	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

Start	End
70	92