CAZyme Information: TREMEDRAFT_60726-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_60726-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		59447.41	6.6449

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711529:2761664-2764217(-)

Full Sequence      

MSHKPTHLLLIPQATWGHVRSCLQIGISLLHLAPNCYLTFLCYSSASPRVHEELSRQHHL
TSEKKRRIRTVDIIGEVREEDDPLRPGLKLRVGFEDVLKGLMMKGEKGEEWGYPNLIIYD
DYQLWPYSLPKVVRELTDHLNQPYIPCLYLAPVPTSPMMRMTASAEHGGHWDGIMKRYED
ARAEGLSINDAGIKALRNAQGKLITPPDLPPMYDYEYYPQNVCMPFPISLLYKWPAMFAA
RDDSDGYMTFGISELEGWSEGQLKKSLKIPLYPVGPHLDIEIWQANNPKVRTSYTSDERR
VVKFLDGMQKEYGSRSACFVSFGSLMWPSTRPELLECLVETLIEAEPPLPFLFAAASALA
SWPDHLIKKVEESGRGMIVKWAPQLTVLQHESIHFFLTHCGSGSTVEAIQAEIPIVAWPF
TGDQVLWAAQLTQMSHCGVRLHQVNSGMKGLQLASGGIVTEDPEDIKREMREAFTAVRGD
QWTEMRDEIRKLGTILKDSVERGAARKAREQIVEKYLSRTLVTGS

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_60726-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	150	439	1.6e-24	0.5078534031413613

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.33e-24	207	514	132	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
178032	PLN02410	1.09e-20	216	521	171	451	UDP-glucoronosyl/UDP-glucosyl transferase family protein
178589	PLN03015	5.51e-17	244	478	205	442	UDP-glucosyl transferase
177813	PLN02152	1.65e-16	269	514	219	452	indole-3-acetate beta-glucosyltransferase
178584	PLN03007	2.44e-16	364	505	332	466	UDP-glucosyltransferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96365.1|GT1	1.23e-40	1	479	1	477
QRW23605.1|GT1	2.06e-40	7	505	8	496
VWP02304.1|GT1	1.21e-36	7	414	8	409
VWO96367.1|GT1	1.23e-36	152	485	85	425
QRV96563.1|GT1	1.70e-36	2	505	3	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ACV_A	6.03e-16	243	473	211	443	Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula],2ACV_B Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula]
2ACW_A	6.08e-16	243	473	211	443	Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula],2ACW_B Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula]
3WC4_A	4.14e-15	314	467	263	412	Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase from Clitoria ternatea [Clitoria ternatea],4REL_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with kaempferol [Clitoria ternatea],4REM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with delphinidin [Clitoria ternatea],4REN_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with petunidin [Clitoria ternatea],4WHM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with UDP [Clitoria ternatea]
2C1X_A	2.39e-14	310	478	266	426	Structure and activity of a flavonoid 3-O glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera],2C1Z_A Structure and activity of a flavonoid 3-O glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera],2C9Z_A Structure and activity of a flavonoid 3-0 glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera]
6LZX_A	8.70e-14	297	505	289	488	Structure of Phytolacca americana UGT3 with 15-crown-5 [Phytolacca americana],6LZX_B Structure of Phytolacca americana UGT3 with 15-crown-5 [Phytolacca americana],6LZY_A Structure of Phytolacca americana UGT3 with 18-crown-6 [Phytolacca americana],6LZY_B Structure of Phytolacca americana UGT3 with 18-crown-6 [Phytolacca americana],7VEJ_A Chain A, Glycosyltransferase [Phytolacca americana],7VEJ_B Chain B, Glycosyltransferase [Phytolacca americana],7VEK_A Chain A, Glycosyltransferase [Phytolacca americana],7VEK_B Chain B, Glycosyltransferase [Phytolacca americana],7VEL_A Chain A, Glycosyltransferase [Phytolacca americana],7VEL_B Chain B, Glycosyltransferase [Phytolacca americana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1V0QSE8|ERIJ_HERER	1.13e-29	1	475	1	460	UDP-glycosyltransferase eriJ OS=Hericium erinaceus OX=91752 GN=eriJ PE=1 SV=1
sp|Q9LTH2|U76E2_ARATH	2.10e-19	255	441	216	392	UDP-glycosyltransferase 76E2 OS=Arabidopsis thaliana OX=3702 GN=UGT76E2 PE=2 SV=1
sp|Q2V6J9|UFOG7_FRAAN	3.53e-18	293	505	261	465	UDP-glucose flavonoid 3-O-glucosyltransferase 7 OS=Fragaria ananassa OX=3747 GN=GT7 PE=1 SV=1
sp|Q494Q1|U76E3_ARATH	3.79e-18	255	441	210	387	UDP-glycosyltransferase 76E3 OS=Arabidopsis thaliana OX=3702 GN=UGT76E3 PE=2 SV=1
sp|Q9LTH3|U76E1_ARATH	5.25e-18	255	441	214	390	UDP-glycosyltransferase 76E1 OS=Arabidopsis thaliana OX=3702 GN=UGT76E1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999946	0.000070

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_60726-t26_1-p1.