CAZyme Information: TREMEDRAFT_60596-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_60596-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		60554.88	5.2611

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711529:2292229-2294933(-)

Full Sequence      

MPANHMVFIPVSISHLRTMLQLMINLLNLHPSLIITLLSLEVYNKRLDQEFALHPKQTLD
AVRDRYRVVMVPDGLDDAGNTLLENSVFLEKGRERVEGLIRGDEEGKWGKRPCAFIIDIE
EATRDRRDDVIMKVWDICRAGARGMIIEITQQMGLPKIPCLRICPTMAMGIYRFCFSDEE
YGIGEKLLDRYEMYKAEGMEELRAANKAIRFIQGKLLEWPDLPPMYDYEWTSQGETITVD
SNYLLFHHMIYTTFHDLDGYICTSIPELDTMALKEIEKSLGKPVYAVGPQFNETIWNVVE
HTHPSDAQRDDNHIISFLNKAHKEQGENCAAYISFGTSFWPNNRPDLIEIIIDSLLLAEP
PIPFIFATASRGKITQKVIDKVHQSGRGLIVDWAPQVQVLSHPAVGMFLTHCGCTSLTET
IVCGVPILALPFAADQPALSAHFTHINPIGIQLTQLLTGLVGRTTGLGEYVEGTEEAMRT
QLADAWTRMRGEEGDKYRMKISELKELMRTGGGNERHDTILMIVMIYADVFNWV

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_60596-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	332	516	2.9e-17	0.3612565445026178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.49e-24	267	437	175	340	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
215465	PLN02863	4.79e-22	259	436	217	393	UDP-glucoronosyl/UDP-glucosyl transferase family protein
178032	PLN02410	9.45e-22	268	520	215	441	UDP-glucoronosyl/UDP-glucosyl transferase family protein
215247	PLN02448	1.45e-21	263	509	215	435	UDP-glycosyltransferase family protein
215127	PLN02210	3.56e-21	190	453	143	391	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV96563.1|GT1	5.68e-32	176	509	149	477
QRW11313.1|GT1	9.06e-31	176	509	149	477
QRV82561.1|GT1	1.23e-30	176	509	149	477
QRV96564.1|GT1	3.05e-30	176	509	149	476
QRW11314.1|GT1	8.75e-29	176	509	149	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2C1X_A	1.09e-16	323	453	266	392	Structure and activity of a flavonoid 3-O glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera],2C1Z_A Structure and activity of a flavonoid 3-O glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera],2C9Z_A Structure and activity of a flavonoid 3-0 glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera]
2ACV_A	4.71e-16	240	436	196	382	Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula],2ACV_B Crystal Structure of Medicago truncatula UGT71G1 [Medicago truncatula]
2ACW_A	4.75e-16	240	436	196	382	Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula],2ACW_B Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose [Medicago truncatula]
6BK1_A	6.24e-15	363	517	314	457	Crystal structure of Os79 T291V from O. sativa in complex with UDP. [Oryza sativa Japonica Group]
5TMB_A	6.24e-15	363	517	314	457	Crystal structure of Os79 from O. sativa in complex with UDP. [Oryza sativa Japonica Group],5TMD_A Crystal structure of Os79 from O. sativa in complex with U2F and trichothecene. [Oryza sativa Japonica Group],5TME_A Chain A, Glycosyltransferase, Os79 [Oryza sativa Japonica Group],6BK3_A Crystal structure of Os79 from O. sativa in complex with UDP and deoxynivalenol-3-glucoside (glucose moitey not resolved) [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LTH2|U76E2_ARATH	7.03e-19	261	510	209	430	UDP-glycosyltransferase 76E2 OS=Arabidopsis thaliana OX=3702 GN=UGT76E2 PE=2 SV=1
sp|A0A1V0QSE8|ERIJ_HERER	9.57e-19	197	477	170	455	UDP-glycosyltransferase eriJ OS=Hericium erinaceus OX=91752 GN=eriJ PE=1 SV=1
sp|Q9STE3|U76E4_ARATH	2.29e-18	268	514	215	438	UDP-glycosyltransferase 76E4 OS=Arabidopsis thaliana OX=3702 GN=UGT76E4 PE=2 SV=1
sp|Q9LTH3|U76E1_ARATH	4.11e-18	261	509	207	427	UDP-glycosyltransferase 76E1 OS=Arabidopsis thaliana OX=3702 GN=UGT76E1 PE=2 SV=1
sp|A0A2Z5CVA1|U77B2_CROXC	5.59e-18	118	506	94	428	Myricetin 3-O-rhamnosyltransferase UGT77B2 OS=Crocosmia x crocosmiiflora OX=1053288 GN=UGT77B2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000014

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_60596-t26_1-p1.