CAZyme Information: TREMEDRAFT_45727-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_45727-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	JH711541|CGC2	55790.12	6.4621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711541:687591-689364(+)

Full Sequence      

MGLLDKFKYNVHPPFQTPSTSSNSSYAQIPTIPLGPSLTPRYRKQRGVNLGSWFVLERWI
TEGPFNDASNAGKSDFDIASGDNAREVLEAHWDGFMSDEDWEWIVERGFNSVRLPIAYYH
LSKPCPGAMRDTEFEPFARVFEGAWERILRAVEDAKRHGLGVLIDLHAAPGAQNPDSHSG
TSHGRVKLFSRSNLRAYSLAIQFLASHFASDPWIVGLELLNEPRNDDRLQHLYETTLSSI
RAIVGPEFPIYISDAWDTPWYASWVGRRTDFVVLDHHLYRCVSPQDTSRSMDELTHDLRH
GFSGYFGGVCDTAKGSVVIGEFSATVAPTSLPNVPDGEKDRLRREYVKAQLDLYERCTAG
WFFWTYKKGAGWDAGWSSKDAARAEILPSFPRKSFRHSNQQKQHELDSAFNSHRDYWACH
GGTPDPESFRSGFLQGWEDAVIFLENGDELGFVGQWSRRRRQEQGRPHDAWEWEHGFKQG
IEAAKRICQI

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_45727-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	370	9.3e-99	0.9929328621908127

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.47e-28	42	376	15	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	5.60e-09	104	366	33	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR99083.1|GH5_50	6.21e-189	1	488	1	496
AUB29314.1|GH5_50	6.21e-189	1	488	1	496
KGB80314.1|GH5_50	5.82e-187	20	488	12	496
ADV25348.1|GH5_50	6.70e-186	20	488	12	496
AAW45154.1|GH5_50	6.70e-186	1	488	1	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PF0_A	7.04e-26	46	367	16	366	Chain A, Hypothetical protein XOG1 [Candida albicans]
1EQP_A	1.64e-25	46	367	10	360	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	2.22e-25	46	367	10	360	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	2.37e-25	46	367	15	365	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PB1_A	2.40e-25	46	367	16	366	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74799|EXG3_SCHPO	4.85e-63	42	477	11	445	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|P38081|YBQ6_YEAST	2.92e-52	2	482	4	496	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|A2RAR6|EXGA_ASPNC	1.78e-33	35	391	30	406	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	6.23e-33	46	391	43	405	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	6.33e-33	46	389	43	404	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_45727-t26_1-p1.