CAZyme Information: TREMEDRAFT_44888-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_44888-t26_1-p1
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885	JH711536|CGC4	98870.79	6.7657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711536:292435-295602(-)

Full Sequence      

MILRQTAWLFALLTLLLSCHLPSVVAFDHARRVQLREEVRKLFVHGYQGYMKYAYPADNL
KPISCTPLGRDPDATNFGINDISPNASLTLLDVLSTLPLIHPSAFPDAVRRVATEISFDQ
NVKVQVFEMTIRALGALLSTHQFLDSLPDDLSLQAKRLGMKRKRVNVKQYQARLLDLAID
LANRFKPAFETPSGIPYARINLRHGMDKGESVETCLAGAGSLILEFGVLSRLTGDETYEN
LAKRAFLALWNRRSSNNLLGNTIGASHGHWLAPGLSGVGAGMDSFFEYSLKASILFADDS
YLDVFQDAYAAVQTNVRTPDGFIYRPVQMKLLHTANPSTIDSLSAFLPGLQVLSGDIESA
IQNHMIWWNLWRKYSATPEVWAWQERRVEWAGWPLRPEYIESTYYLYQATKDPFYLRVGE
RVLRDIVRRVKTKCGFAILRNVESGELEDRMESFMLSETLKYLYLLFDPTPPPRLTNSVF
TTEGHTLSLPHGQLRTPSFVRRAMHRGENQQCPVYRNPELGGLVVGIERRADYDYARSVV
YGPGLEGVWAENESGVKWWEGGFCVIPKAPKWSFDLVLAPSESGILPTTSHSPPSNKIHR
DDQTGNFVISDIQGIILTVRWRLDRTGYDVSSIGPHRIRPGQKVYISDPTISHHVPIPQT
PLPSHLPVELILRFSTYLNSATPGETNNVFLHAIGSTATFGRAFSSNTYGWGFISGPVPL
IRPVENSQGCLPFDETYMGILLLDRGECSFFSKLLHATRAGAAGVVVVGFSQEIQETLVG
EGQGLIRPSAEEESLKISEEIAQSGMIYVDHKIGQGVLKEMKDGVKVAVELLHMDQPIQV
TGHEGKVEDEDGSVSDRQKEDISRGKIFVGEWAVHNIHIINSNIP

Enzyme Prediction     

EC	3.2.1.113:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	43	487	4.9e-129	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.98e-129	42	485	1	449	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.68e-62	22	490	59	519	glycoside hydrolase family 47 protein; Provisional
239040	PA_VSR	3.77e-04	709	759	7	64	PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR). This group includes various PA domain-containing VSRs such as garden pea BP-80, pumpkin PV72, and various Arabidopsis VSRs including AtVSR1. In contrast to most eukaryotes, which only have one or two VSRs, plants have several. This may in part be a reflection of having a more complex vacuolar system with both lytic vacuoles and storage vacuoles. The lytic vacuole is thought to be equivalent to the mammalian lysosome and the yeast vacuole. Pea BP-80 is a type 1 transmembrane protein, involved in the targeting of proteins to the lytic vacuole; it has been suggested that this protein also mediates targeting to the storage vacuole. PV72 and AtVSR1 may mediate transport of seed storage proteins to protein storage vacuoles. The significance of the PA domain to VSRs has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
271199	LanC_SerThrkinase	0.002	171	312	104	234	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW46395.2|GH47	5.41e-316	1	884	1	940
AUB28289.1|GH47	2.01e-313	1	884	1	940
AFR98181.1|GH47	2.01e-313	1	884	1	940
KNX50001.2|GH47	2.64e-311	8	884	10	940
UOH84003.1|GH47	2.70e-280	30	884	4	870

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.64e-36	42	489	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.81e-36	42	489	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.87e-36	42	489	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	5.82e-36	42	489	95	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	7.67e-36	42	489	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92611|EDEM1_HUMAN	2.30e-120	26	489	121	586	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	5.51e-120	26	489	116	581	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|O94726|MNL1_SCHPO	2.05e-118	24	649	24	617	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q6GQB9|EDEM3_XENLA	1.02e-97	26	489	29	484	ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis OX=8355 GN=edem3 PE=2 SV=2
sp|Q9SXC9|MNS5_ARATH	1.54e-96	31	489	33	478	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999782	CS pos: 26-27. Pr: 0.9738

TMHMM  Annotations     

Start	End
7	26