CAZyme Information: TREMEDRAFT_44612-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_44612-t26_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		67557.52	6.5811

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711535:60757-63218(+)

Full Sequence      

MTDKGKTRSRPTVDTSIQSDSHSYLRTRSPSRSRYNQEEDKGQDDDHVRPLFGHLHSPTY
PPRSSQFSSTSIRRLHSLIRLPPSLKRIFLSPVYLVLVFLCVLLTFFFLRSDRPFDTGSP
FPWENPPSSLIKLPEEYAPYLPDLNLPEILLSPQLEPLASQLKKFLLRPVLSYEESDAAN
KKLCPSEISDRLVNPDQYNGDGQFWREGVTPTVVYEKRASLIHFLAKHVEEGRTIFGAEV
GQGQGIVLTGGNQDTTLRMITLLRHLNRLGVKLPVEVFHYPDELHEEEHREAIRELGATI
REIQGVGKVDGVWKNWQIKGQAIIQSSFREVLYIDSDNIPLRDPSHLFSAPHYLNNGRAV
FWPDLSRDHPDNAIWRLVGDTCNLREWTFESGQIVLDKGGNGGLNIAALYLAAGMMADRD
FWFRMCGGDKDTFRWAWRMLDINLATSPRWMSALGFKNGFENGRFCGHTVLQYDLVIHEG
EERERPLFVHSNLLKHLGSANLGRGKLFTHVKRMSLDASHEPTLNYAHAWVYNGAARGMC
LDLDWHPLAYERLTDAEREIQKVEGIPVGQIEGGVFEGFEDAWFDEGGRIGGW

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_44612-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	243	474	9.8e-51	0.9962121212121212

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	3.26e-27	243	474	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	2.42e-06	260	365	17	127	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41452.1|GT71	6.09e-221	133	593	70	529
AUB22503.1|GT71	2.16e-216	133	593	70	529
AFR93017.1|GT71	2.16e-216	133	593	70	529
UOH81712.1|GT71	4.34e-216	133	593	70	529
KGB80352.1|GT71	3.52e-215	133	593	70	529

PDB Hits     

TREMEDRAFT_44612-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A687|MNN22_CANAL	5.09e-09	245	364	164	288	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|Q59WF4|MNN2_CANAL	6.78e-09	245	364	188	310	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
sp|P38069|MNN2_YEAST	2.71e-08	242	370	169	302	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AD72|MNN24_CANAL	6.84e-08	242	379	291	429	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q59KJ7|MNN21_CANAL	2.39e-06	245	364	247	376	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

Start	End
87	109