CAZyme Information: TREMEDRAFT_44147-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_44147-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646		73388.48	6.4635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711532:1449522-1452602(+)

Full Sequence      

MSRRLPFPRLSRPAYLVTGAILVFLLHTLFIRSSESPSSPISPGRTLSRLSSPLLPLRGS
FSPDTSALLPGHERSYDVDIAPSGLTSFHPGDTKHPIELLIERAKRQADSIDAQIEEVTS
LEDSVDEYERGYGMKPPKGFDRWYAFTRRGPVPKPPAVAPLLSAAHNPVVQFLSHPAAVL
RERVKEEGKQAQMFSLELVPDGQGDPGTACTADQEWTTRDWRTRGKGMVKVHGDGGWKFR
CNNTLSLLLPIFPLMPKEMFHLDPPLEILFAVDDAPRGMVHHSFRERGEALGRAMKLWPA
TALHKAEQAMRWTYGWVWACPDDAPLRTQSTDTVLNDMRPAQMPAGVEQLVQPKTFIADF
VKSADVCYNPELMSMNRAARELGLSLATCRYVHSSDLVSAPLDGVWEKVAYIPWEEKPIR
KAFWRGTATGSFHNKKIPWRGSQRERLHFLAHNNSEATAPILVKRDGRWVTESYPVQEMN
EAWLDVGLSDGPTQCSEEDGSCDELEMEIDFMPRVRKEDAVKYKYVIDVDGNGWSSRFRR
LLAGNNVVLKSTVFPEWFNDLMIPWYHYVPVKIDYSDLYDILAFFNGPPDGSAPGRDDLA
KQIAEQGYRFTQEKWRMQDMQSYMFLLLLEYWRVLSDDREANSYHS

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_44147-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	407	635	5.1e-63	0.764

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.56e-26	412	631	78	249	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	6.42e-17	413	631	154	319	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41853.2|GT90	6.92e-237	84	644	64	629
KGB74299.2|GT90	2.04e-232	75	630	60	621
AUB22757.1|GT90	4.24e-232	93	644	80	635
AFR93241.2|GT90	4.24e-232	93	644	80	635
UOH81501.1|GT90	1.03e-223	93	630	80	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.54e-12	519	636	233	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.85e-10	407	635	200	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	6.37e-82	83	640	140	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.28e-11	519	636	261	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.26e-11	519	636	261	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	3.00e-11	519	636	261	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	7.81e-11	519	631	358	463	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000001

TMHMM  Annotations     

Start	End
13	31