CAZyme Information: TREMEDRAFT_44060-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_44060-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1516	JH711532|CGC2	170169.27	5.0569

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711532:1038981-1045907(-)

Full Sequence      

MWWSTVLLVGSALAQSSQPLSIQLTASWPAAPLVLEILETIYDESPSSYFPLLRHLTSLP
PDLSDRDLLSAAKEMILFHDLLPETSWGTFDLALTLHTASPKIEAFYTWYEANVVGETPE
ILLPFDHISAPTGLSQAIFYFDPSSPSSSPLLGYLDHHASQYPSFRYVVRYAPPKNRHEG
PKTQLSGYGVEMVLKKTDYLVVDDRTSRGKTQAHSKSTQGTSSANHSRMFEILGDDPWDQ
WAEPLTKSEVQNLGLQASALIMSSEDKLDALLHLSQDFPKYSAAIARNIDIPQNLAARRE
HLLTRGPASPTLVINGRNFKSSDMNAFSLLNTIRAERHHILSLSSLGLTPKQAFELLADP
LIGQSQTSDDPTEGMVDASDRDEGGKAITWWNNIERDKRYSSWPKQMQGYLRPLYPGQFH
SIRRNTFNLVFVLDLASVPSLDIIAASISGMIQRGVPVRFGIVPMVSPEQEDISMQMARV
FLYAVKTFGRGVTRDMLNEILKASPSSPANPATVRLEVVERVYNWAAMQSDKESLPFSQV
LESHEFDPQFKALQTYTERVAALKEDAPSGHLFLNGKHIPLNGHWATAVQSEIQTQLAFL
QESIINKVPMEDVANFFYDLPMTAKRRNKLIVPTQIDNKLRAHNLLDVFKHDSMNVLTTN
FVYADDYNQAPITIWIIADLDSSAGRRTVMDALESLQLPSNLARIGFVHVPSDVSATNGA
RLSTLIYKLMSSSILNEVQPSQLLDVIQSLEKGDSVEWKEGTPLHAFSSSGWSAADDIAA
ARFWEVGSTIGAELKIRSSHPHLLINGRLVGPITPRSFGVADFQPLATFEYRKRVQPVVA
LVATMYENINSFDRTTLAGMIATMTSIVSAAYIPPGSDGIFTPAPAPRSKWYEQLDDGDM
SFSVGRKDTALVHVAAVVDPISEAAQRFAPILKMLSQMDHVAVSVYLEPDLTSTDLKLKR
FYRSSLSPYPLFDVDGKSIAPGLTFTDLPTSPIYTLGLDLPPSFIVSPKTSPVDLDNILL
STLHDPTTVQFELKQLVIEGHARETTNTPPRGLQLQLIANEKEVSDTLVMINVGYLQFKV
TPGVYDLDIRPGRGQEVYELESVGNEGWDSKSVNETGRRVTVTSFEGMTILPRFVRKKGM
EQADVLQESEIVQPDSMGKAVFSRMKELVGIKPEETKPTTRHADINIFTVASGLLYERFA
SIMILSVMRHTQSSVKFWFIENFLSPTFLEFLPHLAEEYKFQYELVTYKWPSWLREQTEK
QRIIWAYKILFLDVLFPMDLDKVIFVDADQIVRVDMKELVDVDLHGRVYGYAPMGDDREE
MEGFRFWKKGYWRDALRGRPYHISALYVIDLKRFRQLATGDRLRSQYHTLSADPNSLANL
DQDLPNSMQDQIPIYTLDQDWLWCQTWCSDESLARAKTIDLCQNPLTKEPKLVRARQIPE
WDEYDREIAALAARIQGGSGLAGSVDDLAGEKGRESESEPVTGALSVEEHEEGDKEEEER
EAKEVGEKVRRIDDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1185	1432	7.6e-128	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1185	1451	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.85e-176	1185	1432	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	3.93e-72	376	631	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	6.53e-57	1185	1432	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
399437	UDP-g_GGTase	2.44e-48	1039	1147	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV20593.1|GT24	0.0	4	1471	4	1518
AAW41515.2|GT24	0.0	8	1479	10	1571
AUB22656.1|GT24	0.0	8	1479	10	1571
AFR93153.2|GT24	0.0	8	1479	10	1571
UOH81582.1|GT24	0.0	8	1479	10	1574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	7.04e-271	16	1456	7	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	7.04e-271	16	1456	7	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	3.86e-270	16	1456	7	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	4.27e-236	17	1394	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.67e-214	16	1456	7	1218	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	4.93e-207	2	1451	6	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	8.66e-199	14	1456	24	1512	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	4.10e-194	5	1456	32	1528	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	7.51e-192	16	1451	43	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.08e-188	16	1451	43	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999714	CS pos: 14-15. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_44060-t26_1-p1.