CAZyme Information: TREMEDRAFT_43106-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_43106-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		59136.63	4.0990

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711530:183909-186513(+)

Full Sequence      

MTSLALLTLALLTLRSVSSLSLWYTEPGSSSPAGSVAGDKVRGVNLGGWFILENWMMPSF
FGVAPLDQYNILDEWHYCSILGKDECASRLTDHWATYVTEDDFMRFANYSLNTVRIPVGY
WMWIDLEDYEPYVQGQLPYLEKALGWADKYGLDVMIDMHGLPGGQNGQDNQGVKGPIEFA
YNQTNSDRALSAVQNMTQWVTQDKFNGIVKAIELANEPYIQEYNPGGMLFEDLANYYVQS
YQVVRNSEHIIDGGHEVMVFIHDAFQPLANWDYFFSTEGLGLSWTNYGVDTHIYDAFGSS
PDKTWQEHLDTMCYLASSIASAQTKFPVIVGEFSLGTNTYCVDYQSCFGATLADTIANLT
DYETSLFLRQFWEVQSDVYELGAGWIFWSHANEFAAPWSWSQSAAQNWIPEDPTEKIWPF
YSDASSGCLDISNPIAGDQNLPYFPGYANNISNINIDFVRAKYASASSASSTNDNSTSAS
ISSSSGTSSVTSPSSGSSPSASASASSSASGARRRIRGEATEVLGMLLLVVGIMF

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_43106-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	92	392	2.3e-81	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.80e-35	35	399	12	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	0.001	97	339	23	242	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR92508.1|GH5_9	5.73e-238	3	460	5	462
AUB21944.1|GH5_9	5.73e-238	3	460	5	462
AAW40834.1|GH5_9	1.04e-237	15	460	17	462
UOH79346.1|GH5_9	2.32e-237	3	460	5	462
KGB74390.2|GH5_9	6.74e-234	7	460	9	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.23e-58	41	419	9	388	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
4M80_A	3.67e-58	41	419	14	393	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
1CZ1_A	6.31e-58	41	419	9	388	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	7.34e-58	41	419	15	394	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	1.00e-57	41	419	14	393	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9URU6|EXG1_SCHPO	5.70e-66	30	421	28	405	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|A2RAR6|EXGA_ASPNC	1.01e-65	41	419	42	412	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	1.58e-64	39	419	27	400	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|B8N151|EXGA_ASPFN	3.09e-64	38	419	28	402	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	3.09e-64	38	419	28	402	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000253	0.999716	CS pos: 19-20. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_43106-t26_1-p1.