CAZyme Information: TREMEDRAFT_42399-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_42399-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847		97776.34	5.0855

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711528:5400405-5404191(+)

Full Sequence      

MLLVDNWEYTQTTSSTFPDLKEEWKKCSKFPTCIHVELREEGKILDPFKDLNEWDVQWIG
EADWKFRTTFSVSSTQLEEDHADLVFEGLDTYCDIYLNDQKIGFTDNMFIPHRFSCPNLH
EGENELLLHFRSPWLEAKDREKANGGSSKWNGDSCRLHSRKAQYHWGWDWGPKLLTTGPW
RSIKLETHSYRLEEVKVVADLIGPQYNVATLSAKATVSPSLPSTSSHRIGYTLRTLDKKV
IKDDTLLVDEELKWKFSNDEVEAWWPINYGSQTLYELETKLLSKDNEVLAQKITRVGFRY
VKLVQEPLENEEGSSFLFEVNGVRIFCGGSNWIPADSFLTEMTKERYYAWTKMMVDGNQN
MLRVWGGGVYEDQALYDACDELGVLVWQDFMFACGLQYPSTPSFNANVKREAEAVVKRLR
DHPSVVMFAGNNEDYLLAEAEGVIDYKDESGDYMNSKFPARHIYEILLPEVVKAHSSIFY
WRSSPYGGKNTRDQTVGDIHQWDVWHGTQEPWSNWDKLAGRFISEFGMEGYPDLRTIKQW
SDDKSQLFPQSRISVQHNKATGFERRLELYLMENFRHAFDMPSYVYYTQLMQAECLGAAY
RTWRRRWRGKGREYTAGALVWQLNDCWPCVSWAIVDYYLRPKPAYFAIKRELQAYTIGMS
RSDIEVPRDPTTDAFLTIRSQVELWGCNSTLSPKPVHVELSAFDLNSGPVAKISWDITLL
PNSSTEIWTGEIPGQPVRTSRAQIPLPIVLHATIQDETGIIARYSYWPEPYKYLSFPDPI
LEVRVEGEKVNVKCEKPVKGLIFDVNGEEVRWSDQALDVFPGDERVICATGLNGREVKVR
YLGDGSA

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	663	7e-89	0.6090425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.09e-70	7	649	2	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.90e-18	680	773	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV91212.1|GH2	0.0	21	847	84	927
QRW05283.1|GH2	0.0	21	847	34	891
QRW19045.1|GH2	1.53e-313	28	847	16	851
QRV76379.1|GH2	1.12e-312	21	847	34	888
CED84166.1|GH2	1.82e-296	7	846	12	869

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.69e-153	22	821	41	802	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.49e-115	1	830	9	817	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.56e-115	1	830	11	819	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.60e-115	1	830	11	819	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.16e-115	1	830	9	817	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	9.41e-243	3	843	9	853	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q5B7W2|MANBB_EMENI	1.24e-214	2	841	8	838	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|A2QYN2|MANBB_ASPNC	1.44e-213	8	843	6	843	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	1.57e-212	3	843	9	842	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A1CGA8|MANBB_ASPCL	6.68e-212	21	841	23	840	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_42399-t26_1-p1.