CAZyme Information: TREMEDRAFT_42227-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_42227-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44880.78	9.7240

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711528:4201959-4203641(-)

Full Sequence      

MITKAIHIKHVSCIIVLAILTRSFSSILLSLSNVPLFDTSPYLLNTSSTDRAPSATLRWD
AIHFSSIALHGYTYEQQIAFQSGWPILMRLAGEVVRWWRGGGIDVEDVVFGGVVLANLAF
VGAVVMLYELTSLLFSPSFAFITSCLYLLPPTPAVLSSAYTEPIFAFFTFSGYHHALKKN
WLIASLLLAGSSMIRATGVFSSGVLVWLYVFRSDTSSRGPFIIFTRLVKGGIYSLIIISP
FLIFQLYAYLSFCQNGTSRPWCHSHLPIAYSFVQKEYWNVGFLNYWDISQLPNLLISFPV
IIISLHPTIKHLFQPSTLSSRLIPFHLHHLIMTFLLIFSSHTQISLRVISGDPVVWWNIA
QMAFGPKGMTRWGKVWVWWVLIWGAISIPLWKGHYPPA

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_42227-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	38	398	2.7e-93	0.9017199017199017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.74e-39	35	367	37	399	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	5.45e-11	112	361	119	365	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR93820.1|GT76	5.81e-102	17	398	9	420
AUB23397.1|GT76	5.81e-102	17	398	9	420
KGB77682.1|GT76	1.27e-101	34	398	32	423
AAW42711.1|GT76	1.27e-101	34	398	32	423
UOH80020.1|GT76	1.64e-101	34	398	32	420

PDB Hits     

TREMEDRAFT_42227-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP62|GPI18_CRYNJ	2.26e-102	34	398	32	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|P0CP63|GPI18_CRYNB	4.53e-102	34	398	32	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	3.32e-40	9	398	2	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q7TPN3|PIGV_MOUSE	7.46e-33	41	303	44	337	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q5KR61|PIGV_RAT	1.91e-32	41	303	44	337	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.818171	0.181833

TMHMM  Annotations     

Start	End
109	131
146	168
181	211
231	253
372	391