CAZyme Information: TREMEDRAFT_42155-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_42155-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		39078.22	4.0914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711528:3812936-3814809(-)

Full Sequence      

MTRHTNQLLSLFFVSLSLLAVVSAACSASSPCGADAPCCSEYGYCGSGSYCLGGCSPLGS
HSFTSCRPDPICVSGETDFTDLSRVLQNSTAYTGNVTGYDWILNTGTLVPDPNGQGVRLT
LTENDQGTKISSTRYVHYGQIDMTLETSKWQGVVTAAITMSDVHDEIDWEFPGNNTSSGQ
TNYWFLGIANYSATEGQTVTINSDTSSNFHTYSFNWQEDSLQWLVDGNVVRTVNKDDTIV
NGVAKYPTTPSRIEISIWPAGINGSAQGTIDWSGGMINWDDPDYVSNGYFYNTLQSVKVN
CAETASSGNITGWSYTGNGTDGVPVVAETNASLLLNSAKPVYQSAPGVLVLLFTLLSIAL
LGCNI

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_42155-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	113	278	4.1e-64	0.9482758620689655

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.83e-80	92	302	3	202	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	6.29e-48	104	274	1	168	Glycosyl hydrolases family 16.
185684	GH16_lichenase	5.01e-23	113	259	37	184	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
211314	ChtBD1_GH16	3.76e-20	24	70	1	47	Hevein or Type 1 chitin binding domain subfamily that co-occurs with family 16 glycosyl hydrolases. This subfamily includes Saccharomyces cerevisiae Utr2p, also known as Crh2p, which participates in the cross-linking of chitin to beta(1-3)- and beta(1-6) glucan in the cell wall, and S. cerevisiae Crr1p, a putative transglycosidase which is needed for proper spore wall assembly. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
225182	BglS	1.57e-16	122	314	101	294	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR92726.2|CBM18|GH16_19	1.15e-131	55	339	56	342
AUB22189.1|CBM18|GH16_19	1.15e-131	55	339	56	342
UOH79555.1|CBM18|GH16_19	1.15e-131	55	339	56	342
AAW41079.1|CBM18|GH16_19	1.93e-120	55	339	57	343
KGB75532.1|CBM18|GH16_19	1.18e-119	55	337	57	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	1.26e-27	101	307	35	229	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
1AXK_A	1.43e-16	132	318	8	191	Engineered Bacillus Bifunctional Enzyme Gluxyn-1 [Bacillus subtilis],1AXK_B Engineered Bacillus Bifunctional Enzyme Gluxyn-1 [Bacillus subtilis]
1CPN_A	1.59e-15	132	288	8	157	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]
1MAC_A	3.19e-15	94	284	25	201	Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	3.31e-15	94	284	27	203	MOLECULAR AND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32623|CRH2_YEAST	2.83e-56	55	337	56	339	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q4WI46|CRF2_ASPFU	3.47e-55	55	312	56	311	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q5AJC0|UTR2_CANAL	1.42e-51	60	297	63	298	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q75A41|CRR1_ASHGO	1.80e-39	99	299	159	359	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1
sp|Q05790|CRR1_YEAST	5.64e-35	104	299	155	351	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999786	CS pos: 24-25. Pr: 0.9778

TMHMM  Annotations     

Start	End
341	363