CAZyme Information: TREMEDRAFT_41693-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_41693-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		68993.87	3.9184

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711528:1735952-1738144(-)

Full Sequence      

MSTFLSLLYLALLPTIIVTTANPDVTVYTGQATATTSAAADSTYTGLPAYDPTVLTPPPA
PQPPINSYTLALPASAADLGSNYSLSIPQKGNFLGFSIELSVANTVLGEKGNELKVPFLN
YMANIRDRAGAGPIIRVGGNSQEGSTIFADGLEDGESLDKIKVSDDVTATPIINYSPELL
YTMANISTLLDVEWFFGLAFNETSVDGNDVNIPVAAEWAQKILGSNLRGLAVGNEPDLYV
DHSARPAGWGVSDYVNEYKTVVDTIVNANVLSNSQTFIGPSVCCQREGFELDDVIAASWL
SDNQDRLAAVTVQHYPTNNCDGTIQAQDIFADFLNHTSAESLTSLYLSNSAELQAAGKEL
IMLEMNTASCGGFPGLSDSFGAAMWMTDWALQLAWANFSAALMHVGGQNVYYNPFLPPPS
SMAKVYQWTTGSVYYSTLVIAEVFGSSNKSQVVDLQVDDANIYHPAYAIYEDGQPTRVVL
FNYINDPTGASQLTVNIASSAFSVSVRYLSAPTVSEQYNITWAGQTLGVSFSSDGRLYGT
EQTSVVQCTDGNCPIEVSAPSIAVVYLTDQALADSSVPQDATSTYATTVVGHGSATVEAG
ALSTGNGQNAPSGVSGSTSEGSTSGSLRQYCTPSLWAALGLVIWLFPVAVR

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_41693-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	92	537	3.2e-59	0.9296703296703297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	5.51e-20	466	564	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW46890.1|GH79	6.17e-260	24	608	30	626
UOH85196.1|GH79	7.67e-256	24	626	30	642
ADV25490.1|GH79	3.10e-255	26	643	32	660
KGB78976.2|GH79	8.83e-255	24	643	30	660
AFR98329.1|GH79	1.25e-254	24	621	30	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BWI_A	3.70e-19	73	565	9	443	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]
7DFQ_A	1.77e-15	122	574	47	466	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	5.10e-09	185	532	123	444	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	5.23e-09	185	532	123	444	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	1.22e-08	185	532	143	464	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	3.03e-17	75	567	31	541	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	3.36e-13	120	491	63	444	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999766	CS pos: 21-22. Pr: 0.9605

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_41693-t26_1-p1.