CAZyme Information: TREMEDRAFT_40831-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_40831-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653		73967.60	6.2752

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711541:355726-358041(-)

Full Sequence      

MSITLARPSMSRTKKTAIVFLVLLSLVLIGTVVVLSTVSYYLAIPTMAYLTEEEVPWRAE
DVIGPLRNSDMPQIRAEHPTIGRFSEEEMTDGDEVEGENGYDEEQQWEDEMWGPDGKGTG
GYWMRAGWEGQVQGTDSWQRLFNVTTRPGEKIPRLIHQTWKNDQLPEKWREAWKECREGM
PDYEYMLWTDDLSRAFIAEYYPSQLHMFDSYKYPIQRADSIRYFVLNHFGGVYMDLDIGC
RRRLDSLLRGDWEVVLPVTKPVGVSNDLILSSKGSAFMDDTVHALSAFNHEYLTNYPTVM
FSTGPMFLSAQYAIYSSAHPLTPTRPRAQVRILPKTLYGKNAAPSSVPHSFFSHYYGSSW
HSDDAGFITFLGKWGKNLMYLSFIVILIGAIRLVYQRYRSSSNEYQLVSLLPISLPNVGV
SLPDTHTTSGTSTPTTPPTSRSTLTSSTSATSEGPFSPTLDLITSDRLPSEIASAFRRAG
HLILAAPATLLSRTGRRKTGLLYYVPALFQPTQTSRRGRTASEASQLPLRTPKRQRSDPP
SHHYQQPRPTSPSQSSNQYYQTQMKSGGQYDDGSSPSRVRTQRTEAPPPYDPHELQSRQR
EENKVENDAEEEKDTLLRSVDGLERTTDQSGSHDDWDRSQRWSQDQNTHGDDT

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_40831-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	168	248	1.9e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.61e-48	150	368	80	288	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.48e-22	166	248	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76679.2|GT32	1.18e-219	9	536	13	570
ADV23773.1|GT32	2.08e-217	14	536	68	620
UOH84801.1|GT32	4.67e-205	9	536	13	565
AUB28991.1|GT32	2.21e-202	15	536	68	614
AFR98795.2|GT32	2.21e-202	15	536	68	614

PDB Hits     

TREMEDRAFT_40831-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	1.91e-61	145	412	55	319	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	7.98e-52	152	388	57	282	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.06e-47	152	373	82	294	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.89e-47	152	365	55	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	5.97e-47	142	371	50	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994168	0.005848

TMHMM  Annotations     

Start	End
20	42
378	395