CAZyme Information: TREMEDRAFT_40623-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_40623-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	JH711539|CGC3	62154.57	4.4477

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711539:397530-401196(-)

Full Sequence      

MEDGTEFVYINWMGGNWAVDPEKPYTVSGRAQDWSPSLLEDWKWGQNIVRGVNLGGWLVT
EPFIVPALYEQYQNSNPQAVDEYTLSQALGDNLATVMEDHYKTFITEQDFAEIAQAGLNW
VRIPLGYWAIATEGDEPFLAQVSWTYFVKAIAWARKYGLRILLDFHALPGSQNGWNHSGK
AGSINWMYGVMGIANAQRHLEYIRSLTEYISQDGIKQVVPMISLVNEVEASIVGMEVMQA
FYYQAYQLIRGITGFGTGNGPIIAIHEGFVGIAKWEGFLNGADRLSLDQHPYLAFGGANT
NPWSWQQSTACSWGGGTNDTQTSFGLVMGGEWSLAINDCGKWLVGVGGTPSYQSLSNCTQ
WDEWFNYSDQTKSDLLGYAKANMDALQNWFFWTWKIGNSTELGYASSPFWHYKLGWQNGW
IPGDPRVAGGYCKSIGIGGSQFEGTFPASATGGVASPTIDPSQVSNHSVWPPTSIGPSFT
SAQIALFPTRTQTGTPIILPTPAHAANATIGSGWSDTADTTGAWVLVNGCNYPPEYSATD
ASLLPTALCTGGAAKRDIPSIPTSAPMMV

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_40623-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	99	396	2.1e-92	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.59e-29	48	401	17	369	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75903.2|GH5_9	4.99e-292	4	551	231	786
AUB26004.1|GH5_9	1.95e-291	4	559	228	796
AFR96122.1|GH5_9	1.95e-291	4	559	228	796
AAW44208.2|GH5_9	6.02e-288	4	551	228	783
UOH81920.1|GH5_9	6.45e-278	4	559	228	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	5.25e-70	42	422	2	379	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.03e-69	42	422	2	379	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.22e-69	42	422	8	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	2.33e-69	42	422	7	384	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	3.35e-69	42	422	8	385	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WMP0|EXGD_ASPFU	2.39e-84	28	422	401	809	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	2.39e-84	28	422	401	809	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|A1DMX4|EXGD_NEOFI	3.39e-84	28	422	402	810	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgD PE=3 SV=1
sp|Q0CHZ8|EXGD_ASPTN	5.18e-82	28	422	406	814	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1
sp|Q5AVZ7|EXGD_EMENI	9.02e-80	36	422	410	807	Glucan 1,3-beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgD PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_40623-t26_1-p1.