CAZyme Information: TREMEDRAFT_39913-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_39913-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757		83084.67	4.2098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711535:967767-971609(-)

Full Sequence      

MWSLLTVYLLTQLTVTAQNITSSSASASSSFSPTPVTTSVPSPTGSLNDTVPGQNGYPPA
QYWCKAGSNEPFCAGQLLQDVELSGIFGDSKTFPDKPTLHNLSETYAAFNQLPANVTVGQ
IEQFVEQYFKGEGLELEQVPIEGFNSTPALLNNISDPIYQGWVSVVNSYWTLLIRQTNQS
ALCNGDCESSLIPLNNTIVVPGGRYREIYYWDSYWILQGLLKSQLFEYATDLLTNFMDFI
SVYGFVPNGGRIYYLNRSQPPMFVQMLDAYIQETGNLTMLERALPLASAEMLWWYNNRSI
TVTSPYTGLNRTVYHYSVTNTAPRPEGYQEDYETVMGTTPTLNDTGKADLYSELASGAES
GWDYSARWCKQPVINLSDNNPALRTLNVRAIVPVDLNSLLAGDHALLANLYEVYANSTNF
INSTDSGNSTGSANSTDSSNSTTAYHRQMASNLSDAILDLHWDPAKSWFYDFNLTSNNRS
ELYTPAGTIPLWQNITPPEVVGNDTAALSVVSGARYLLGKYPGIPSVATLLYTGLNWDFP
NSWPPHVYTSIKAFETLGRVNPNASVLTNLTLSFDNVTTGQLGLNESQLQPQDPSLGGNT
TLQVQNTEGKPWPLALSVEWAERYMQAAFCTWYSTGGEIPNLLTQLPISQLNASGTYTAG
TTGVMFEKFNITDPDASGGGGEYTVQVGFGWTNGVVLWLANEFGQYLPQPNCPLIPIIEL
ENGKNVTVFGNGTEVNGTVYGNGTQMGIYTGYRIPRK

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	86	559	4.3e-117	0.869653767820774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	4.83e-105	86	704	2	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.55e-102	72	704	13	545	alpha,alpha-trehalase
224541	TreA	6.22e-60	75	697	59	546	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	6.79e-57	76	704	51	537	alpha,alpha-trehalase TreA.
237326	treA	8.34e-56	75	697	49	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44482.2|GH37|3.2.1.28	0.0	17	757	18	761
KGB76251.2|GH37	0.0	17	757	18	762
ADV23702.1|GH37	0.0	17	757	18	757
AFR96750.2|GH37	0.0	17	757	18	762
AUB26705.1|GH37	0.0	17	757	18	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	5.32e-56	100	704	53	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	6.73e-55	100	704	53	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	4.87e-52	75	701	15	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	9.13e-49	75	697	15	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
5Z66_A	3.74e-48	75	701	52	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	5.76e-98	72	712	54	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	1.05e-87	64	707	31	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	7.89e-86	69	711	47	579	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|P19813|TREA_RABIT	9.22e-86	72	707	33	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	6.04e-82	69	707	30	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000296	0.999667	CS pos: 17-18. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_39913-t26_1-p1.