CAZyme Information: TREMEDRAFT_38370-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_38370-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		41181.30	6.1050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711530:1344618-1346338(-)

Full Sequence      

MLPLLLLLPLLTPITASSHRNILARRNHADLALRAQHSTTMEARMARRAAGKRLASRAAQ
KCRAKGSLPSLSVASSSTPSTSTSIVASSSSTSTQTSTSSADPTTTSTTGTTSTTDAGTS
QETTGSSYNVQVSSGSSSGGNTGMTPNGNKAGISGGDAFDYFKDHIGWWYDWTPNPSGHW
GSPMAVPMLWGAGTVDSTDSDRFSEFLAISSSPAYIIGFEEPDCYGSGSAGIDVSTAAGI
WNNHVAPHGSAGSLLLSPSMCHQAAETGWLQPFAQQINRGWDITNLHINKNSASGIQADL
DHYWNTYGKPMWITEFACVDDSTGFVPCTDQSEINNYIWTAVQIFESDSRVAGYAYSNGA
GLGNVWPLMNGGQFSESGQTYLAAVKQYH

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_38370-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	163	381	3.7e-49	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	9.14e-43	165	381	17	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PNP47955.1|GH128	2.81e-88	144	389	6	254
UKZ69748.1|GH128	9.05e-87	144	389	6	254
QYT06237.1|GH128	1.23e-85	144	389	22	270
UKZ58231.1|GH128	6.98e-85	144	389	22	270
UKZ94447.1|GH128	4.69e-84	144	389	6	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	5.32e-107	145	389	198	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	2.14e-89	144	389	28	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAX_A	3.63e-18	143	384	88	345	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	2.96e-11	148	384	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	7.25e-11	148	384	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	2.07e-11	160	383	312	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.569037	0.430965

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_38370-t26_1-p1.